PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G068600.1
Common NamePOPTR_0002s06920g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 606aa    MW: 67207.1 Da    PI: 7.9415
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G068600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.32.4e-2963147187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe++aL+++r++m+ ++r+++ k+plWe+vs+k++e g++rs+k+Ckek+en+ k++k++k+g++++  ++ +t+++fdqlea
  Potri.002G068600.1  63 RWPRQETMALLKIRSDMDVAFRDASVKGPLWEDVSRKLAELGYNRSAKKCKEKFENVYKYHKRTKDGRSGK--QEGKTYRFFDQLEA 147
                         8********************************************************************96..55557*******85 PP

2trihelix100.41.4e-31429514187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k ev aLi +r++++ +++++  k+plWee+s+ mr+ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  Potri.002G068600.1 429 RWPKVEVEALIGLRTNLDCKYQENGPKGPLWEEISAGMRKLGYNRNAKRCKEKWENINKYFKKVKESSKKR-PEDSKTCPYFHQLDA 514
                         8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007179.8E-460122IPR001005SANT/Myb domain
PfamPF138374.1E-1962147No hitNo description
PROSITE profilePS500906.99262120IPR017877Myb-like domain
CDDcd122033.16E-2462127No hitNo description
SMARTSM007171.3426488IPR001005SANT/Myb domain
PfamPF138375.8E-22428515No hitNo description
PROSITE profilePS500906.864428486IPR017877Myb-like domain
CDDcd122035.89E-27428493No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MLGDSSSVLA TTTTTLAASG GGGVGNREAP PLTGGHHEGR NIDVGGEDDK GVIEGHRGIG  60
GNRWPRQETM ALLKIRSDMD VAFRDASVKG PLWEDVSRKL AELGYNRSAK KCKEKFENVY  120
KYHKRTKDGR SGKQEGKTYR FFDQLEAFQS HPPSLSSPLP PQPTKPHIPP ANTIAMPVVN  180
PSPNVVGTSR NTVPSTAAAT LATNTSQGIV TSAINLAVPP FPSTDPTICP PSQATNPTNH  240
PRTNIPSSFP NFSSDLNSNS TSSSTSSDVE LQGRRKRKRK WKDFFERLMT EVIQKQEETQ  300
NKFLEAIAKR ENERMVREES WRMQEMARIN REREISAQER SIAATKDAAV MAFLQKLSEQ  360
QNPGQVQNNP PPTQPPPPAL PPISQQTPTP TPPPPLPVAQ VPPPQPVANL DIMKSDNGDQ  420
NFMSASSSRW PKVEVEALIG LRTNLDCKYQ ENGPKGPLWE EISAGMRKLG YNRNAKRCKE  480
KWENINKYFK KVKESSKKRP EDSKTCPYFH QLDALYKEKN KIDGPSNSTH HMKPQNSVPL  540
MVLPEQQWPP AQQEHRPDSM MGDLESDDNQ NQEDGDDKFM DDEDEDEASG YEIVANKQTS  600
MNTAG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1273278RRKRKR
2273279RRKRKRK
3274279RKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2276020.0CU227602.1 Populus EST from severe drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302180.10.0trihelix DNA-binding family protein
SwissprotQ391171e-141TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLB9GTJ30.0B9GTJ3_POPTR; Trihelix DNA-binding family protein
STRINGPOPTR_0002s06920.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-151Trihelix family protein