PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G068400.1
Common NamePOPTR_0002s06900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 594aa    MW: 66528 Da    PI: 5.392
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G068400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.11.3e-2960144187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe+laL+++r++m+  +r++ lk+plWeevs+k++e g++rs+k+Ckek+en+ k++k++keg+ ++++++s  +++fd+lea
  Potri.002G068400.1  60 RWPRQETLALLKIRSDMDAVFRDSGLKGPLWEEVSRKLAELGYHRSAKKCKEKFENVYKYHKRTKEGRTGKSEGKS--YKFFDELEA 144
                         8********************************************************************9877776..******985 PP

2trihelix103.81.3e-32407492187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k ev+aLi++r +++ +++++ +k+plWe++s+ m++ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyfdql+a
  Potri.002G068400.1 407 RWPKVEVQALINLRANLDVKYQENGAKGPLWEDISAGMQKLGYNRSAKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFDQLDA 492
                         8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.17853117IPR017877Myb-like domain
SMARTSM007170.02357119IPR001005SANT/Myb domain
CDDcd122032.86E-2459124No hitNo description
PfamPF138372.3E-2059144No hitNo description
SMARTSM007171.5E-4404466IPR001005SANT/Myb domain
PROSITE profilePS500907.12406464IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.0E-4406463IPR009057Homeodomain-like
PfamPF138376.2E-23406493No hitNo description
CDDcd122032.68E-26406471No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MIGDSSVQAT SSDVAATATR VATEGGEGGG GGGFGSNSAE EDKTMGVDHE GNRMNYGANR  60
WPRQETLALL KIRSDMDAVF RDSGLKGPLW EEVSRKLAEL GYHRSAKKCK EKFENVYKYH  120
KRTKEGRTGK SEGKSYKFFD ELEAFQNHPP HSTQPPTLTP PPLPPPKAQT ASATITTLPW  180
TNNNTAIVSH ATVPSRTNPM DIMSQSIATP TNNRAISPMP ISSNPINPSQ NAYPSSLQNL  240
TTHLLASSSP SSTASDEELE VSYKKRKRES NWKDFFERLT RDVIKKQEDL QEKFLETIEK  300
YEHERMAREE AWRMQEMARI NREHETLIQE RSTAAAKDAA VVAFLQKISG QQNSVQTQEI  360
PQPTTTPTAP PSQPLQLRPP PSLAPVAKLE VPKRDNGDNF TVSSSSRWPK VEVQALINLR  420
ANLDVKYQEN GAKGPLWEDI SAGMQKLGYN RSAKRCKEKW ENINKYFKKV KESNKKRPED  480
SKTCPYFDQL DALYKEKNKM EITVNSDYAV KPTSTMEPLM VRPEQQWPFQ QATQPQTIIE  540
DNERNINIDH NIEDDDDDDV VVDDDDVDTD EEDEGGGFEV VANKSAPLVN GDQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN3157820.0JN315782.1 Populus tomentosa SANT DNA-binding domain-containing protein (GT2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300920.20.0hypothetical protein POPTR_0002s06900g
SwissprotQ391171e-149TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLB9GTJ10.0B9GTJ1_POPTR; Uncharacterized protein
STRINGPOPTR_0002s06900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-130Trihelix family protein