PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G062000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 164aa    MW: 18197.6 Da    PI: 9.1195
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G062000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.32.7e-15957149
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        k+i+n+  r+vtfskRr+g++KKA+ L+   +a++a++ +s +g+l+++
  Potri.002G062000.1  9 KKIQNEDYRKVTFSKRRAGLIKKAKFLCSGSNAQIAIVSYSLSGRLFTF 57
                        689*********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.292161IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-20160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-20278IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-13323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-141057IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-132338IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-133859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MTRRKIEIKK IQNEDYRKVT FSKRRAGLIK KAKFLCSGSN AQIAIVSYSL SGRLFTFGHP  60
SVDSVVDPFL DNYTTDSCGS SSNESPHVST HGPSPPSRGV VDGKEGRPSW WALPVEDMDL  120
DMDGLRQYKA SLEILKSNVA SRLKEMEERA SLTRDFVGFL DAH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G062000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024451981.11e-119agamous-like MADS-box protein AGL61
TrEMBLA0A2K2BEB91e-112A0A2K2BEB9_POPTR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2316234
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-24AGAMOUS-like 61