PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G058800.1
Common NamePOPTR_0002s05980g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 275aa    MW: 30354.1 Da    PI: 9.9081
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G058800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK67.12.6e-211758748
              RWP-RK  7 ledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48
                         e +sk+Fslp+ dAA++Lgvc++vLK+iCR +G++RWP+Rk
  Potri.002G058800.1 17 WEAISKHFSLPLSDAANNLGVCVSVLKKICRDNGLDRWPYRK 58
                        689**************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.971181IPR003035RWP-RK domain
PfamPF020428.2E-201758IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MNIQQQQQPN QSKPPSWEAI SKHFSLPLSD AANNLGVCVS VLKKICRDNG LDRWPYRKYL  60
AGKSIEDIRR YAAREKIKAI ADLAKAANKS GIQQQNNENS KPHKLQQQGT KDVLVGRQHI  120
TLTPGLAKGL MGLDEFKYGF PSDGLSTATN KWWGSSLSDT QRATDRAGIE TDEDDGRQSE  180
EKVDAGTSVV IVDEEKGENG KMESNEIDPQ GTGLLTSVRK RAAEEGREAL KLGVYRTYGV  240
NKLGRKQRAL LLRIFGSSLP KQWIQDFSSN RGGL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G058800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1485940.0EF148594.1 Populus trichocarpa x Populus deltoides clone WS0134_I13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300875.10.0uncharacterized protein LOC7468732
TrEMBLB9GT260.0B9GT26_POPTR; Nin-like family protein
STRINGPOPTR_0002s05980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1312233
Representative plantOGRP866899
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38340.13e-10Nin-like family protein