PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G056700.1
Common NamePOPTR_0002s05770g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 226aa    MW: 25714 Da    PI: 6.7184
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G056700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.41.9e-291871255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtp LHe+Fveave+LGG+ kAtPk+il++m+vk L ++h+kSHLQ+YR+
  Potri.002G056700.1 18 PRLRWTPVLHEHFVEAVESLGGKYKATPKRILQMMSVKELRISHIKSHLQMYRS 71
                        9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-271472IPR009057Homeodomain-like
SuperFamilySSF466891.97E-131671IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-221872IPR006447Myb domain, plants
PfamPF002494.8E-71970IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MKTSEANGAR QYNKSEHPRL RWTPVLHEHF VEAVESLGGK YKATPKRILQ MMSVKELRIS  60
HIKSHLQMYR SMKGPRNFNV IIPMMKHLQA ERKLLDGKGI SSSFSSQRVL QGERSDSKCD  120
MFSDIESNGI LQAQEEGGDP EQQDSGTSFV GSQSREENID RLPAETCELS LSSFIPSMAS  180
CTTEERELWP LINDQHHREY TSTNKCIIIQ DLQFESNRIN LDLTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-171973458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-171973458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-171973357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-171973357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-171973357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-171973357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-171973458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-171973458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-171973458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-171973458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-171973458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-171973458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G056700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302131.21e-169protein PHOSPHATE STARVATION RESPONSE 1
RefseqXP_024450832.11e-169protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLA0A2K2BE091e-168A0A2K2BE09_POPTR; Uncharacterized protein
STRINGPOPTR_0002s05770.11e-167(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91862839
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.16e-24G2-like family protein