PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G038500.2
Common NamePOPTR_0002s03960g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 242aa    MW: 27512.9 Da    PI: 5.0082
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G038500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.2e-163681148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+++ eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Potri.002G038500.2 36 RGNFSREEEDTIIKLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 81
                        89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.51E-211791IPR009057Homeodomain-like
PROSITE profilePS500904.0541730IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.6E-111743IPR009057Homeodomain-like
PROSITE profilePS5129425.2713185IPR017930Myb domain
SMARTSM007171.4E-143583IPR001005SANT/Myb domain
PfamPF002492.7E-153681IPR001005SANT/Myb domain
CDDcd001674.18E-113881No hitNo description
Gene3DG3DSA:1.10.10.601.3E-224482IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MLVLNHFFLT HFSGLLRCGK SCRLRWINYL RPDIKRGNFS REEEDTIIKL HEMLGNRWSA  60
IAARLPGRTD NEIKNVWHTH LKKRLEQNHF APEINGRSVD VSRFNHELKT GPEIVSSSNV  120
VAAGCDQSKE HRPISPQQCS SDVSSVTTVD TSNDMCTKVA ESDDFLEMDE IFWSEVLSAD  180
NSSMMSDYSA ISTEPQLQFP FSPLIIDVEQ VQATNSNMYD GMDFWHNLFT RAGELPELTE  240
I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-1978632109B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G038500.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302045.11e-170transcription factor MYB14
TrEMBLB9GS151e-169B9GS15_POPTR; Uncharacterized protein
STRINGPOPTR_0002s03960.11e-170(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-48myb domain protein 14