PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G035200.2
Common NamePOPTR_0002s03660g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 294aa    MW: 32837.5 Da    PI: 8.1868
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G035200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.72e-3172128259
         ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                         +++rY eCl+NhAas+Gg+++DGCgEfmp  geeg+ +alkCaAC+CHRnFHRre + 
  Potri.002G035200.2  72 SNTRYLECLRNHAASVGGNVFDGCGEFMPG-GEEGSLEALKCAACDCHRNFHRRELDG 128
                         5789*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2267130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.6E-2874126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.0E-2875125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.24176125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.0E-29212282IPR009057Homeodomain-like
SuperFamilySSF466898.61E-19212281IPR009057Homeodomain-like
TIGRFAMsTIGR015651.7E-29221278IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEIRGPENDI RTSVPSSYSH QSSGLERRKD GNHNGSSVLT FTQTLDHPRQ PSRSPNPDRL  60
AIISSGSNSK TSNTRYLECL RNHAASVGGN VFDGCGEFMP GGEEGSLEAL KCAACDCHRN  120
FHRRELDGEI QFSPGSRRST TMVHSLQLAP PLPSPTVLHH HHHHQRYSMG LHTSPNTANM  180
VQPMSVAFGG TSGGTESSSE ELNPFQSNAE GAPPPPYVMS KKRHRTKFTQ EQKDKMMEFA  240
EKVGWRINKQ DEEEVERFCA EVGVRRQVFK VWMHNNKNLK KQQQQQVPLD ENP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-242202781674ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.145120.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in flowers and inflorescence. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Binds DNA at 5'-ATTA-3' consensus promoter regions. Regulates floral architecture and leaf development. Regulators in the abscisic acid (ABA) signal pathway that confers sensitivity to ABA in an ARF2-dependent manner. {ECO:0000269|PubMed:16428600, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21779177}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G035200.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by abscisic acid (ABA) and ARF2. {ECO:0000269|PubMed:21779177}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302028.10.0zinc-finger homeodomain protein 5
SwissprotQ9FRL55e-65ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLB9GRN00.0B9GRN0_POPTR; Uncharacterized protein
STRINGPOPTR_0002s03660.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-51homeobox protein 31