PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G009700.2
Common NamePOPTR_0002s01060g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 664aa    MW: 73313.4 Da    PI: 6.2565
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G009700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.1e-29612662151
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                         aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik+
  Potri.002G009700.2 612 AEKTITLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGINRWPSRKIKK 662
                         589**********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.859602663IPR003035RWP-RK domain
PfamPF020426.6E-25615662IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MEDGGLSPGT MLGATVDSVS VMDFDYMDEL LLEGCWLETT DGSEFLNPSL SNSAAFFDSS  60
FMWPTPEINH GDSASSPSQK GNQEDNQISM FPGNSTLSDI QARSPAGETA VSVAGWDDNA  120
TDGSELGKRW WIGPTPNPSV ETSVKRRLIK ALECIKDLTK NKDVLIQIWV PVNRGGRRVL  180
TTHDQPFSLD PSSEKLASYR DISVKYQFSA EEDSKDSVGL PGRVFLGKVP EWTPDVRFFR  240
SDEYPRVNHA QLYDVRGTLA LPVFEQGSRT CLGVIEVVTT SQKIKYRPEL ESVCKALETV  300
DLRSSEVPSI QNLQACNMSY QAALPEIQKL LRAACETHRL PLAQTWVPCT QQGKGGCRHS  360
NENYYRCVST VDDACCVADS AIQGFQEACS EHHLLKGQGV AGQAFMTNQP CFSGDVTSYG  420
KTEYPLSHHA RMFGLCAAVA IRLRSIYIGT TDFVLEFFLP VNCRDPQEQK KMLNSLSAII  480
QHVSQTLRVV TDKELVEETD LPFSEVLVPS DGRSSGEETS TVKQSCSERH SRDNSPWTAC  540
LSEVQPSGSN ISLSQKDKQK VMLREKSSEN RENQEDCSLR ESIKCGRDST SAEGSFSSAG  600
TSKTGEKRRA KAEKTITLQV LRQYFAGSLK DAAKSIGVCP TTLKRICRQH GINRWPSRKI  660
KKN*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G009700.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024451282.10.0protein NLP4
RefseqXP_024451283.10.0protein NLP4
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A2K2BBL50.0A0A2K2BBL5_POPTR; Uncharacterized protein
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein