PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G008800.3
Common NamePOPTR_0002s00980g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 162aa    MW: 18466.7 Da    PI: 5.7267
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G008800.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.4e-212282257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        r+R+t+++ ql++Le+ Fe+ n +p ++++++++++l    +++e++V++WFqNrRa+ k+
  Potri.002G008800.3 22 RQRWTPKPAQLQILEQIFEQcNATPGRQKIKDITRELaqhgQISETNVYNWFQNRRARSKR 82
                        89*****************99**************************************97 PP

2Wus_type_Homeobox96.52.1e-312184265
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        +r+RWtP+p Q++iLe+++++   tP +++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
  Potri.002G008800.3 21 SRQRWTPKPAQLQILEQIFEQCNATPGRQKIKDITRELAQHGQISETNVYNWFQNRRARSKRKQ 84
                        589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.48E-181785IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-181786IPR009057Homeodomain-like
PROSITE profilePS5007114.7381883IPR001356Homeobox domain
SMARTSM003892.6E-132087IPR001356Homeobox domain
CDDcd000869.14E-142284No hitNo description
PfamPF000461.3E-182282IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MGLGNPYCDP LLSSAVHKIG SRQRWTPKPA QLQILEQIFE QCNATPGRQK IKDITRELAQ  60
HGQISETNVY NWFQNRRARS KRKQSAVVPN NGESEMETDI ESLKEKKTRA EDSQPDENTT  120
PMADHMYFNS PDIGFDQLMG KIESPGSCIP YWQMEQYDLF G*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17583RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G008800.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0108100.0AJ010810.1 Populus tremula X Populus tremuloides mRNA for homeodomain protein HB1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301917.11e-120WUSCHEL-related homeobox 8
SwissprotQ5QMM38e-44WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLB9GQ011e-119B9GQ01_POPTR; WOX family protein
STRINGPOPTR_0002s00980.11e-120(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.12e-42WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]