PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G008800.1
Common NamePOPTR_0002s00980g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 216aa    MW: 24483.6 Da    PI: 5.1489
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G008800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.2e-2076136257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r+R+t+++ ql++Le+ Fe+ n +p ++++++++++l    +++e++V++WFqNrRa+ k+
  Potri.002G008800.1  76 RQRWTPKPAQLQILEQIFEQcNATPGRQKIKDITRELaqhgQISETNVYNWFQNRRARSKR 136
                         89*****************99**************************************97 PP

2Wus_type_Homeobox95.73.9e-3175138265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         +r+RWtP+p Q++iLe+++++   tP +++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
  Potri.002G008800.1  75 SRQRWTPKPAQLQILEQIFEQCNATPGRQKIKDITRELAQHGQISETNVYNWFQNRRARSKRKQ 138
                         589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-1771140IPR009057Homeodomain-like
SuperFamilySSF466894.71E-1871139IPR009057Homeodomain-like
PROSITE profilePS5007114.73872137IPR001356Homeobox domain
SMARTSM003892.6E-1374141IPR001356Homeobox domain
PfamPF000462.3E-1876136IPR001356Homeobox domain
CDDcd000865.82E-1476138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MEEGRFQNGG GLGVKVMTDE QMEMLRKQIS VYATICEQLV EMHKALSAQQ DFAGMGLGNP  60
YCDPLLSSAV HKIGSRQRWT PKPAQLQILE QIFEQCNATP GRQKIKDITR ELAQHGQISE  120
TNVYNWFQNR RARSKRKQSA VVPNNGESEM ETDIESLKEK KTRAEDSQPD ENTTPMADHM  180
YFNSPDIGFD QLMGKIESPG SCIPYWQMEQ YDLFG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129137RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G008800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0108100.0AJ010810.1 Populus tremula X Populus tremuloides mRNA for homeodomain protein HB1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301917.11e-163WUSCHEL-related homeobox 8
SwissprotQ5QMM35e-71WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLB9GQ011e-162B9GQ01_POPTR; WOX family protein
STRINGPOPTR_0002s00980.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Representative plantOGRP18731639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.16e-67WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]