PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G002400.1
Common NamePOPTR_0002s00440g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 1074aa    MW: 119091 Da    PI: 8.2894
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G002400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.41.3e-40145222178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +Cqv++C++dls+ak+yhrrhkvC+vhska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+q+
  Potri.002G002400.1 145 MCQVDNCKEDLSKAKDYHRRHKVCQVHSKATKALVGKQMQRFCQQCSRFHPLTEFDEGKRSCRRRLAGHNRRRRKTQP 222
                         6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-33140207IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.727143220IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.62E-37144224IPR004333Transcription factor, SBP-box
PfamPF031102.2E-29146219IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1074 aa     Download sequence    Send to blast
MEEVGAQVAA PIFIHEALSS RYCDMTSMAK KHDLSYQSPN SQLQQHQFLQ ASREKNWNSK  60
AWDWDSVGFV AKPSVAAETL RLGTVSREPK KKDKSDSKNK SNSVNEDDDG LGLNLGGSLT  120
SVEEPVSRPN KRVRSGSPGN GSYPMCQVDN CKEDLSKAKD YHRRHKVCQV HSKATKALVG  180
KQMQRFCQQC SRFHPLTEFD EGKRSCRRRL AGHNRRRRKT QPEDVTSRLL LPGNPDMNNN  240
GNLDIVNLLT ALARSQGRND DKSTNCPTVP DKDQLIQILN KINSLPLPMD LAAKLSNIAS  300
LNVKNPNQPY LGHQNRLNGT ASSPSTNDLL AVLSTTLAAS APDALAILSQ RSSQSSDNDK  360
SKLPGPNQVT VPHLQKRSNV EFPAVGVERI SRCYESPAED SDYQIQESRP NLPLQLFSSS  420
PENESRQKPA SSGKYFSSDS SNPIEERSPS SSPPVVQKLF PLQSTAETMK SEKMSVSREV  480
NANVEGDRSH GCVLPLELFR GPNREPDHSS FQSFPYRGGY TSSSGSDHSP SSQNSDPQDR  540
TGRIIFKLFD KDPSHFPGTL RTKIYNWLSN SPSEMESYIR PGCVVLSVYL SMPSASWEQL  600
ERNLLQLVDS LVQDSDSDLW RSGRFLLNTG RQLASHKDGK VRLCKSWRTW SSPELILVSP  660
VAVIGGQETS LQLKGRNLTG PGTKIHCTYM GGYTSKEVTD SSSPGSMYDE INVGGFKIHG  720
PSPSILGRCF IEVENGFKGN SFPVIIADAS ICKELRLLES EFDENAVVSN IVSEEQTRDL  780
GRPRSREEVM HFLNELGWLF QRKSMPSMHE APDYSLNRFK FLLIFSVERD YCVLVKTILD  840
MLVERNTCRD ELSKEHLEML YEIQLLNRSV KRRCRKMADL LIHYSIIGGD NSSRTYIFPP  900
NVGGPGGITP LHLAACASGS DGLVDALTND PHEIGLSCWN SVLDANGLSP YAYAVMTKNH  960
SYNLLVARKL ADKRNGQISV AIGNEIEQAA LEQEHVTISQ FQRERKSCAK CASVAAKMHG  1020
RFLGSQGLLQ RPYVHSMLAI AAVCVCVCLF FRGAPDIGLV APFKWENLNY GTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31136219184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vasculature of aerial parts. Expressed in cotyledons and leaf petioles. {ECO:0000269|PubMed:15703061}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00664PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.002G002400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024450222.10.0squamosa promoter-binding-like protein 14 isoform X1
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2K2BB790.0A0A2K2BB79_POPTR; Uncharacterized protein
STRINGPOPTR_0002s00440.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Representative plantOGRP71381115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]