PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G415200.4
Common NamePOPTR_0001s44090g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 558aa    MW: 62193.9 Da    PI: 6.0121
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G415200.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS427.98.2e-1311875561373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA+a+++++ ++ ++l ++ +  +s +g+p+qRl ay+ e+L ar  +s+ ++y++l+++e +    ++ l+++++++e++P+l
  Potri.001G415200.4 187 LKQLLIACAKALAENNVSAFDNLTEKARSVVSISGEPIQRLGAYLIEGLVARKESSGANIYRTLKCREPE---GKDLLSYMHILYEICPYL 274
                         689******************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf++++aN aI ea  +e+r+HiiDf+i qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  + + le++++rL+ + e++++p+ef+ 
  Potri.001G415200.4 275 KFGYMAANGAIAEACRNEDRIHIIDFQIAQGTQWMTLLQALAARPSGAPHVRITGIDDPVSKyaRGDGLEAVARRLSAISEKFNIPVEFHG 365
                         ***********************************************************999999************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          v     d++ e+L+v+pgEalaVn+ lqlh+++desv+++++rd +L+++ks +Pkvv++veqe+++n+++F++rf+e+l+yy a+f+s+
  Potri.001G415200.4 366 -VPVFAPDVTKEMLDVRPGEALAVNFPLQLHHTPDESVDVNNPRDGLLRMIKSFNPKVVTLVEQESNTNTTPFVTRFVETLNYYLAMFESI 455
                         .6888999*********************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +++lpr+ +eri+vE+++l+r+ vnv+aceg+er+erhe ++kW++r+++aGF+++pls+++++ +k+llr+++ + y++ e++g+++lgW
  Potri.001G415200.4 456 DVTLPRDRKERISVEQHCLARDMVNVIACEGKERVERHELFRKWKSRFMMAGFQQYPLSTYVNSVIKSLLRTYS-EHYTLVENDGAMLLGW 545
                         **************************************************************************.55************** PP

                GRAS 363 kdrpLvsvSaW 373
                         kdr+L+s+SaW
  Potri.001G415200.4 546 KDRNLISASAW 556
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.145161538IPR005202Transcription factor GRAS
PfamPF035142.8E-128187556IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MESHQYFGYG VTGNSPSSPF YTQFDICDTY TATLSDSQEC YSSTDNLSGV SPSRNSSLES  60
NSYFNRPSPS VDCRLESLQL FSGGTSSLQD ASSSQNIKHA LQELETALMG PDDDEELNTS  120
NASLGESSSR PQTSDQKPKA WRQGSHVIQN QTSFVSRQRQ LGEGAHVEKR QKSMEEGPLH  180
GIPPGDLKQL LIACAKALAE NNVSAFDNLT EKARSVVSIS GEPIQRLGAY LIEGLVARKE  240
SSGANIYRTL KCREPEGKDL LSYMHILYEI CPYLKFGYMA ANGAIAEACR NEDRIHIIDF  300
QIAQGTQWMT LLQALAARPS GAPHVRITGI DDPVSKYARG DGLEAVARRL SAISEKFNIP  360
VEFHGVPVFA PDVTKEMLDV RPGEALAVNF PLQLHHTPDE SVDVNNPRDG LLRMIKSFNP  420
KVVTLVEQES NTNTTPFVTR FVETLNYYLA MFESIDVTLP RDRKERISVE QHCLARDMVN  480
VIACEGKERV ERHELFRKWK SRFMMAGFQQ YPLSTYVNSV IKSLLRTYSE HYTLVENDGA  540
MLLGWKDRNL ISASAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-601895576375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.21850.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006370596.10.0hypothetical protein POPTR_0001s44090g
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLU5GUE20.0U5GUE2_POPTR; Uncharacterized protein
STRINGPOPTR_0001s44090.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein