PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G415200.3
Common NamePOPTR_0001s44090g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 450aa    MW: 50454.4 Da    PI: 6.8417
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G415200.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS428.94.1e-131794481373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA+a+++++ ++ ++l ++ +  +s +g+p+qRl ay+ e+L ar  +s+ ++y++l+++e +    ++ l+++++++e++P+l
  Potri.001G415200.3  79 LKQLLIACAKALAENNVSAFDNLTEKARSVVSISGEPIQRLGAYLIEGLVARKESSGANIYRTLKCREPE---GKDLLSYMHILYEICPYL 166
                         689******************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf++++aN aI ea  +e+r+HiiDf+i qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  + + le++++rL+ + e++++p+ef+ 
  Potri.001G415200.3 167 KFGYMAANGAIAEACRNEDRIHIIDFQIAQGTQWMTLLQALAARPSGAPHVRITGIDDPVSKyaRGDGLEAVARRLSAISEKFNIPVEFHG 257
                         ***********************************************************999999************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          v     d++ e+L+v+pgEalaVn+ lqlh+++desv+++++rd +L+++ks +Pkvv++veqe+++n+++F++rf+e+l+yy a+f+s+
  Potri.001G415200.3 258 -VPVFAPDVTKEMLDVRPGEALAVNFPLQLHHTPDESVDVNNPRDGLLRMIKSFNPKVVTLVEQESNTNTTPFVTRFVETLNYYLAMFESI 347
                         .6888999*********************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +++lpr+ +eri+vE+++l+r+ vnv+aceg+er+erhe ++kW++r+++aGF+++pls+++++ +k+llr+++ + y++ e++g+++lgW
  Potri.001G415200.3 348 DVTLPRDRKERISVEQHCLARDMVNVIACEGKERVERHELFRKWKSRFMMAGFQQYPLSTYVNSVIKSLLRTYS-EHYTLVENDGAMLLGW 437
                         **************************************************************************.55************** PP

                GRAS 363 kdrpLvsvSaW 373
                         kdr+L+s+SaW
  Potri.001G415200.3 438 KDRNLISASAW 448
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.14553430IPR005202Transcription factor GRAS
PfamPF035141.4E-12879448IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MGPDDDEELN TSNASLGESS SRPQTSDQKP KAWRQGSHVI QNQTSFVSRQ RQLGEGAHVE  60
KRQKSMEEGP LHGIPPGDLK QLLIACAKAL AENNVSAFDN LTEKARSVVS ISGEPIQRLG  120
AYLIEGLVAR KESSGANIYR TLKCREPEGK DLLSYMHILY EICPYLKFGY MAANGAIAEA  180
CRNEDRIHII DFQIAQGTQW MTLLQALAAR PSGAPHVRIT GIDDPVSKYA RGDGLEAVAR  240
RLSAISEKFN IPVEFHGVPV FAPDVTKEML DVRPGEALAV NFPLQLHHTP DESVDVNNPR  300
DGLLRMIKSF NPKVVTLVEQ ESNTNTTPFV TRFVETLNYY LAMFESIDVT LPRDRKERIS  360
VEQHCLARDM VNVIACEGKE RVERHELFRK WKSRFMMAGF QQYPLSTYVN SVIKSLLRTY  420
SEHYTLVEND GAMLLGWKDR NLISASAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-61814496375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.21850.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006370596.10.0hypothetical protein POPTR_0001s44090g
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLU5GUE20.0U5GUE2_POPTR; Uncharacterized protein
STRINGPOPTR_0001s44090.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-180GRAS family protein