PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G395100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 206aa    MW: 23745.7 Da    PI: 8.8085
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G395100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.22.4e-1756108456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         + ++t++q++ Le+ F  n+++  e + +LA++lg++ rq+ +W+qN+Ra++k
  Potri.001G395100.1  56 KKRLTEDQVRLLERTFTTNKKLEPELKVQLANQLGVPPRQIAIWYQNKRARWK 108
                         5679************************************************9 PP

2HD-ZIP_I/II106.12.6e-3455145292
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +k+rl+++qv+lLE++F++++kLepe Kv+la++Lg+ prq+a+W+qn+RAR+kt+ lE dy++L+ ++++  ++++rLe+ev +L+eel 
  Potri.001G395100.1  55 NKKRLTEDQVRLLERTFTTNKKLEPELKVQLANQLGVPPRQIAIWYQNKRARWKTQSLELDYNTLQVRLENALADRRRLEREVVRLQEELW 145
                         79*************************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.64550110IPR001356Homeobox domain
SMARTSM003891.5E-1452114IPR001356Homeobox domain
SuperFamilySSF466895.56E-1754119IPR009057Homeodomain-like
PfamPF000469.6E-1556108IPR001356Homeobox domain
CDDcd000863.95E-1456111No hitNo description
Gene3DG3DSA:1.10.10.603.7E-1857117IPR009057Homeodomain-like
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MNPPISLTKL SHLHNFQYNH FPAFLSSNSV SFSNRMDFFN SQTQQKQQYL PKHNNKKRLT  60
EDQVRLLERT FTTNKKLEPE LKVQLANQLG VPPRQIAIWY QNKRARWKTQ SLELDYNTLQ  120
VRLENALADR RRLEREVVRL QEELWQAQQM VFAVNQETAA QPAVNFSCNS SCDDRGSSSL  180
HEGVNGEVLQ LEELYACLYG AGGGF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.157680.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G395100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1469370.0EF146937.1 Populus trichocarpa clone WS01225_C08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006370197.21e-152homeobox-leucine zipper protein ATHB-52
TrEMBLA0A2K2CAW71e-151A0A2K2CAW7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s40540.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110112239
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.11e-33homeobox protein 52