PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G380900.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family STAT
Protein Properties Length: 643aa    MW: 72992.6 Da    PI: 5.9329
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G380900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT171.71.2e-5321031018118
                STAT  18 evvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypfleavskpirCi 108
                         ++vasL+yadsgl+vek++d+e+pLL+s+dG+ef+s+drp kll+G+as+klkisqLsskcdnrLfrik+eipk++ y+flea+s+pirCi
  Potri.001G380900.2 210 KIVASLVYADSGLPVEKTSDDEDPLLASCDGIEFASYDRPGKLLHGHASLKLKISQLSSKCDNRLFRIKLEIPKFSGYHFLEAFSHPIRCI 300
                         79***************************************************************************************** PP

                STAT 109 srsrntrsss 118
                         srsrn r+s 
  Potri.001G380900.2 301 SRSRNPRTSL 310
                         *****99764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2002.4E-714165IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498991.34E-527168IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF133856.5E-728169No hitNo description
CDDcd103387.88E-55530637No hitNo description
Gene3DG3DSA:3.30.505.101.5E-6534621IPR000980SH2 domain
SuperFamilySSF555504.18E-8535610IPR000980SH2 domain
PROSITE profilePS500019.485541642IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MGSDNNNVIN RKDYMLLKDF RKEIEVENEK DFSISFWVYL INSSTAAFPA TIIKQVYSDI  60
SSDAPFLVLN EKKIITLFPF LHAHKETTNF SNSTSMEIEF PLENWIHVGC EVVTDMLRFH  120
INGKIVREQP QSFSLDKSSN SNGLRKITLA GAGGDDALQG YVHHVEVLPL SMSIKEHYVK  180
DPPVRLSIDL SSTSEIDEDS DRIWNIVGGK IVASLVYADS GLPVEKTSDD EDPLLASCDG  240
IEFASYDRPG KLLHGHASLK LKISQLSSKC DNRLFRIKLE IPKFSGYHFL EAFSHPIRCI  300
SRSRNPRTSL TWKRPTSAAD PLNKHQSFGL CNGSLELQQN SIHKIKPRTQ LARGAENIEE  360
ADNSPSVSDS IEERLSDFNI MSSGGYSISD VIIFKYCLGG LTDRALLLKE VATSASEEEL  420
FRLANEVSLY SGCSHHRRQI VISKRLIEEG TKFWNSISQN NRHIQWENVI FEIEERFMRI  480
TCSNTRSLTE QDFELLRRIS GCGEYMAQEN FEKIWRWLYP VAFTLTSDSI NTIWNSTSPK  540
WIEGFITKEE AELSLQGPRG LQEPGTFVLR FPTSRSWPHP DAGCLIVTYV GSDYTVHHRL  600
LSLDYIYSCE ESEMNGKSLE DMLFAEPELS RLGRIVRQRQ LT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers. {ECO:0000269|PubMed:15073273}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G380900.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2080850.0AC208085.1 Populus trichocarpa clone JGIACSB05-D05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024455331.10.0SH2 domain-containing protein A
SwissprotB5X5610.0SHA_ARATH; SH2 domain-containing protein A
TrEMBLA0A2K2CAA60.0A0A2K2CAA6_POPTR; Uncharacterized protein
STRINGPOPTR_0001s38990.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.10.0SH2 domain protein A
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]