PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G380900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family STAT
Protein Properties Length: 707aa    MW: 79831.3 Da    PI: 5.9391
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G380900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT198.37.2e-622193361118
                STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipk 91 
                         ldvvllna+ q+v+k++e+vasL+yadsgl+vek++d+e+pLL+s+dG+ef+s+drp kll+G+as+klkisqLsskcdnrLfrik+eipk
  Potri.001G380900.1 219 LDVVLLNAICQAVNKELEIVASLVYADSGLPVEKTSDDEDPLLASCDGIEFASYDRPGKLLHGHASLKLKISQLSSKCDNRLFRIKLEIPK 309
                         8****************************************************************************************** PP

                STAT  92 lkkypfleavskpirCisrsrntrsss 118
                         ++ y+flea+s+pirCisrsrn r+s 
  Potri.001G380900.1 310 FSGYHFLEAFSHPIRCISRSRNPRTSL 336
                         **********************99764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2002.9E-714165IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF498991.57E-527168IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF133857.7E-728169No hitNo description
CDDcd103385.40E-55594701No hitNo description
Gene3DG3DSA:3.30.505.101.7E-6598684IPR000980SH2 domain
SuperFamilySSF555505.16E-8599674IPR000980SH2 domain
PROSITE profilePS500019.485605706IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MGSDNNNVIN RKDYMLLKDF RKEIEVENEK DFSISFWVYL INSSTAAFPA TIIKQVYSDI  60
SSDAPFLVLN EKKIITLFPF LHAHKETTNF SNSTSMEIEF PLENWIHVGC EVVTDMLRFH  120
INGKIVREQP QSFSLDKSSN SNGLRKITLA GAGGDDALQG YVHHVEVLPL SMSIKEHYVK  180
DPPVRLSIDL SSTSEIDEDS DRIWNIVGGK ASCRRIFSLD VVLLNAICQA VNKELEIVAS  240
LVYADSGLPV EKTSDDEDPL LASCDGIEFA SYDRPGKLLH GHASLKLKIS QLSSKCDNRL  300
FRIKLEIPKF SGYHFLEAFS HPIRCISRSR NPRTSLTWKR PTSAADPLNK HQSFGLCNGS  360
LELQQNSIHK IKPSPSSKRI KLGQERTSAT GQPDVACYSD TWTTNQVANA VGTQLARGAE  420
NIEEADNSPS VSDSIEERLS DFNIMSSGGY SISDVIIFKY CLGGLTDRAL LLKEVATSAS  480
EEELFRLANE VSLYSGCSHH RRQIVISKRL IEEGTKFWNS ISQNNRHIQW ENVIFEIEER  540
FMRITCSNTR SLTEQDFELL RRISGCGEYM AQENFEKIWR WLYPVAFTLT SDSINTIWNS  600
TSPKWIEGFI TKEEAELSLQ GPRGLQEPGT FVLRFPTSRS WPHPDAGCLI VTYVGSDYTV  660
HHRLLSLDYI YSCEESEMNG KSLEDMLFAE PELSRLGRIV RQRQLT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers. {ECO:0000269|PubMed:15073273}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G380900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2080850.0AC208085.1 Populus trichocarpa clone JGIACSB05-D05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024455331.10.0SH2 domain-containing protein A
SwissprotQ56XZ10.0SHB_ARATH; SH2 domain-containing protein B
TrEMBLA0A2K2CAA60.0A0A2K2CAA6_POPTR; Uncharacterized protein
STRINGPOPTR_0001s38990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Representative plantOGRP59411618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]