PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G361700.3
Common NamePOPTR_0001s37270g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 534aa    MW: 59072.9 Da    PI: 5.0696
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G361700.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.87.3e-1371635331374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+e+L +cA a+++gd+  +++l+++l++++s +g+p+qRl ay++e+L arla+s+s++y+al+++e +    ++ l+++ l++e++P++
  Potri.001G361700.3 163 LKEALCTCALAIANGDMFTVEWLMSELRQMVSVTGEPIQRLGAYMLEGLVARLASSGSSIYNALRCKEPA---GADLLSYMLLLYEACPYF 250
                         5789*****************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf+++ aN aI +a++ e  vHiiDf+i qG QW++L+qaLa+Rp+gpp++RiTg+++++s   +   l  +g+rL k+Ae+ +vpfef++
  Potri.001G361700.3 251 KFGYMSANGAIADAMKDEISVHIIDFQIAQGSQWVTLIQALAARPGGPPRIRITGIDDSTSAyaRGGGLDIVGKRLLKLAESYKVPFEFHT 341
                         **********************************************************998899999************************ PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +  + +++++e+L ++pgEa+aVn++l lh+l+desv ++++rd++L+lvkslsPkvv++ve+e+++n+ +F++rf+e+l+yy a+f+s+
  Potri.001G361700.3 342 -AGVSASEIQIENLGIQPGEAVAVNFALTLHHLPDESVGTQNHRDRLLRLVKSLSPKVVTLVEHESNTNTVPFFARFVETLNYYLAIFESI 431
                         .8999************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +++lpre+++ri+vE+++l+re+vn+vacegaer+erhe l+kWr+r+e+aGF+p+pls+++++++k ll++++++ y++ee++g+l+lgW
  Potri.001G361700.3 432 DVTLPRENKKRISVEQHCLAREVVNIVACEGAERVERHEPLGKWRSRFEMAGFTPYPLSSFVNSTIKILLENYSEK-YTLEERDGALFLGW 521
                         **************************************************************************65.************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         ++rpLv+ +aWr
  Potri.001G361700.3 522 MNRPLVASCAWR 533
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.903137514IPR005202Transcription factor GRAS
PfamPF035142.5E-134163533IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MQTSQKKTIS DGSRRYGDQP MQYQESYCWP PIQNIDAGSQ GTHLSPMTSD QYCTLESSSE  60
TSAYPVQNSP STASFSPNES VVSQPNSRSY PSDLQDSSEN ACGSPTSESY VTHKLRELET  120
AMLGPDSDNL DMHSMTAMPG PNQIVSEAEK WKFLVEMMSR GDLKEALCTC ALAIANGDMF  180
TVEWLMSELR QMVSVTGEPI QRLGAYMLEG LVARLASSGS SIYNALRCKE PAGADLLSYM  240
LLLYEACPYF KFGYMSANGA IADAMKDEIS VHIIDFQIAQ GSQWVTLIQA LAARPGGPPR  300
IRITGIDDST SAYARGGGLD IVGKRLLKLA ESYKVPFEFH TAGVSASEIQ IENLGIQPGE  360
AVAVNFALTL HHLPDESVGT QNHRDRLLRL VKSLSPKVVT LVEHESNTNT VPFFARFVET  420
LNYYLAIFES IDVTLPRENK KRISVEQHCL AREVVNIVAC EGAERVERHE PLGKWRSRFE  480
MAGFTPYPLS SFVNSTIKIL LENYSEKYTL EERDGALFLG WMNRPLVASC AWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-661655336375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300358.20.0hypothetical protein POPTR_0001s37270g
RefseqXP_006369988.10.0hypothetical protein POPTR_0001s37270g
RefseqXP_006369989.10.0hypothetical protein POPTR_0001s37270g
SwissprotQ8H1250.0SCL5_ARATH; Scarecrow-like protein 5
TrEMBLB9GJX20.0B9GJX2_POPTR; Uncharacterized protein
STRINGPOPTR_0001s37270.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.10.0scarecrow-like 5