PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G314800.2
Common NamePOPTR_0001s32200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 304aa    MW: 32843.1 Da    PI: 6.628
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G314800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.12.3e-343892155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  Potri.001G314800.2 38 KPRLRWTAELHERFVDAVAQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRL 92
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.5493595IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-333593IPR009057Homeodomain-like
SuperFamilySSF466891.97E-173795IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-243893IPR006447Myb domain, plants
PfamPF002492.2E-94091IPR001005SANT/Myb domain
PfamPF143797.4E-27135181IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MYSAIHSLPL DGHGDFQAAL DGTNLPGDAC LVLTTDPKPR LRWTAELHER FVDAVAQLGG  60
PDKATPKTIM RTMGVKGLTL YHLKSHLQKY RLGKQSCKES TDNSKDASVA ESQDTGSSTS  120
ASSRMIAQDL NDGYQVTEAL RVQMEVQRRL HEQLEVQRRL QLRIEAQGKY LQSILEKACK  180
ALNDQAVATA GLEAAREELS ELAIKVSNER AGIAPLDTMK MPSISELAAA LENKHASNVP  240
ARVGDCSVES CLTSTGSPVS PMGVGAQVAS TKKRSRPVFG NGDSLPFDGN IQQEVEWTMN  300
NIV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-193894157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-193894157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-193894157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-193894157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-193894258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.163920.0bud| leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G314800.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1468170.0EF146817.1 Populus trichocarpa clone WS01214_H04 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006369801.10.0protein PHR1-LIKE 3
SwissprotQ8LAJ71e-137PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLU5GS230.0U5GS23_POPTR; Uncharacterized protein
STRINGXP_002518104.10.0(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-120G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]