PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G309100.1
Common NamePOPTR_0001s31660g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 503aa    MW: 57379.4 Da    PI: 5.3384
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G309100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.11.4e-2942125186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW+kqe+laL+++r++m+ +++++ lk+plWeevskk+ e g++rs+k+Ckek+en+ k+++++keg+++r  ++ +t+++f+ql+
  Potri.001G309100.1  42 RWPKQETLALLKIRSDMDVAFKDSGLKAPLWEEVSKKLNELGYNRSAKKCKEKFENIYKYHRRTKEGRSGR--PNGKTYRFFEQLQ 125
                         8********************************************************************97..55568******98 PP

2trihelix1024.5e-32339424187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k+e+ aLi +r+++e +++++  k+plWee+s+ m++ g+ rs+k+Ckekwen+nk++k++ke++k+r +++s+tcpyf+ql+a
  Potri.001G309100.1 339 RWPKEEIEALIGLRTKLEFQYEENGPKGPLWEEISASMKKLGYDRSAKRCKEKWENMNKYFKRVKESNKRR-PGDSKTCPYFQQLDA 424
                         8********************************************************************97.9************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.3173599IPR017877Myb-like domain
SMARTSM007172.2E-439101IPR001005SANT/Myb domain
PfamPF138373.5E-2041127No hitNo description
CDDcd122032.00E-2341106No hitNo description
SuperFamilySSF466894.36E-5335408IPR009057Homeodomain-like
SMARTSM007179.3E-4336398IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-5337396IPR009057Homeodomain-like
PROSITE profilePS500907.642338396IPR017877Myb-like domain
CDDcd122031.34E-24338403No hitNo description
PfamPF138373.6E-22339425No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MEASTTFPEN SNAATGNRDS DEGDEEMRVK AEEGDQHSTG NRWPKQETLA LLKIRSDMDV  60
AFKDSGLKAP LWEEVSKKLN ELGYNRSAKK CKEKFENIYK YHRRTKEGRS GRPNGKTYRF  120
FEQLQALDNT EVLLPPPSSD KVHTSMAAAL VNPVSFIPNA VPCSIQSPGM NFVDTTSTST  180
ASTSSEEEEG TRKKKQKLTG FFERLMKEVI EKQENLQNKF LEAIEKCEQE RIAREEAWKM  240
QELDRIKRER ELLVRERAIA AAKDAAVLAF LQKFSEQGIS VQLPDNPIVP MKFPDNQTVP  300
VPSSAPVQLP KNQAVPVENI VKTRENSSIE SFVNISPSRW PKEEIEALIG LRTKLEFQYE  360
ENGPKGPLWE EISASMKKLG YDRSAKRCKE KWENMNKYFK RVKESNKRRP GDSKTCPYFQ  420
QLDALYREKN RRVDGSGFEL KPEELLMHMM GGQGDQQQPE SATTEDRESE NVDQNQENYR  480
DKEDGDGDRI VANDPSSMEI ME*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298711.20.0hypothetical protein POPTR_0001s31660g
SwissprotQ391171e-127TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLB9GGS30.0B9GGS3_POPTR; Uncharacterized protein
STRINGPOPTR_0001s31660.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-115Trihelix family protein