PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G298400.1
Common NamePOPTR_0001s30570g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-PHD
Protein Properties Length: 931aa    MW: 102136 Da    PI: 4.6676
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G298400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox36.58.3e-128408811152
                         HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
            Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                          ++ L ++F++nryp++++++ LA++lg+t +qV  WF N R
  Potri.001G298400.1 840 VTQKLYSFFKENRYPDQAAKASLAEELGITFEQVNKWFMNAR 881
                         6899************************************99 PP

2PHD39.21.5e-13471526151
                         SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                 PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                         +C+ Cg+   +++++++lCdg C++ fH+ Cl ++l +e++p g   wlC+ C++k
  Potri.001G298400.1 471 FCAKCGSkdLTADNDIILCDGaCDRGFHQFCLVPPLLREDIPPGdeGWLCPGCDCK 526
                         699***977778********66********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579039.08E-14461529IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.106.3E-13467526IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.941469526IPR019787Zinc finger, PHD-finger
PfamPF006284.1E-11471526IPR019787Zinc finger, PHD-finger
CDDcd155043.45E-27471523No hitNo description
SMARTSM002491.3E-9471524IPR001965Zinc finger, PHD-type
PROSITE patternPS013590472523IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.604.3E-12823881IPR009057Homeodomain-like
SMARTSM003898.0E-10825891IPR001356Homeobox domain
SuperFamilySSF466894.71E-11835884IPR009057Homeodomain-like
PfamPF000462.3E-9840881IPR001356Homeobox domain
CDDcd000865.91E-11841881No hitNo description
PROSITE profilePS5007111.742844887IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 931 aa     Download sequence    Send to blast
MSEAEHMGVS PSKVSHTKSY SCPAQTTLEN THEPSAEYKF GGYPEERHKL ECEIIQTEAG  60
DNRAAVLQSC SGEVVQPSTD DLTKSPLIDL DPPPDDARSA LFDNSPRPIS TAMDQKLEPG  120
ATSVNTACVH SESSKAIDSS ILLDEPRNSN TELSSCIANE TSQASLEGLA NDSRAEDAGL  180
SLVEASNSDL IDESSYSQQT TSGQTREFHS DRACCKPLEE RQKPGSELAE NESMEIGIGL  240
PSGIAIENLE PLTELVTKSC PIKHIGLPPG DDISIPANEQ IRPTHDKESK YPDCEHLEKL  300
SGIVIGITSQ GVPSVKRTSK LSGKKYTSSS RKSDRVLRSN SQEKPKAPES SNNSTNVNST  360
GEEKGKRRKK RRGKSIVADE YSRIRARLRY LLNRMSYEQS LITAYSGEGW KGLSLEKLKP  420
EKELQRATSE IIRRKVKIRD LFQHIDSLCG EGRFPASLFD SEGQIDSEDI FCAKCGSKDL  480
TADNDIILCD GACDRGFHQF CLVPPLLRED IPPGDEGWLC PGCDCKVDCI DLLNDSQGTN  540
ISISDRWDNV FPEAAAVASG QKLDYNFGLS SDDSDDNDYD PDGPDIDEKS QEESSSDESD  600
FSSASDEFEA PPDDKQYLGL PSDDSEDDDY DPDAPVLEEK LKQESSSSDF TSDSEDLDAT  660
LNGDGLSLGD EYHMPIEPHE DSNGRRSRFG GKKNHSLNSK LLSMLEPDSH QEKSAPVSGK  720
RNIERLDYKK LYDETYGNIS TSSDDDYTDT VAPRKRRKNT GDVAMGIANG DASVTENGLN  780
SKNMNQELKK NEHTSGRTHQ NSSFQDTNVS PAKTHVGESL SGSSSKRVRP SAYKKLGEAV  840
TQKLYSFFKE NRYPDQAAKA SLAEELGITF EQVNKWFMNA RWSFNHSSPE GTSKAESASG  900
KGSCDGHVRD SESKNQKSNK QKTSTPKSRR *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1365371KRRKKRR
2368373KKRRGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300247.20.0homeobox family protein
TrEMBLB9GHU20.0B9GHU2_POPTR; Homeobox family protein
STRINGPOPTR_0001s30570.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18301539
FabidsOGEF84373141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-88Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain