PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G293300.1
Common NamePOPTR_0001s30040g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 520aa    MW: 58316.7 Da    PI: 5.0575
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G293300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK94.66.9e-30202253152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+isl++l+kyFs+++kdAAk++gvc+T+LKriCRqyGI+RWP+Rkik++
  Potri.001G293300.1 202 AEKTISLQVLRKYFSGSLKDAAKSIGVCPTTLKRICRQYGINRWPSRKIKKV 253
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.768190273IPR003035RWP-RK domain
PfamPF020429.0E-25205253IPR003035RWP-RK domain
SuperFamilySSF542775.23E-22410504No hitNo description
Gene3DG3DSA:3.10.20.2402.8E-19419500No hitNo description
PROSITE profilePS5174518.47420503IPR000270PB1 domain
SMARTSM006661.9E-20420503IPR000270PB1 domain
PfamPF005641.1E-13421500IPR000270PB1 domain
CDDcd064075.02E-33421502No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MEGGAFRKNT IFRATSDTFM DLNFTDELLV QGYWCERSDG VNFFEPEPSI SSVVYDPSPY  60
LPCMGSGHLS VNTHDLTYQE ESENSLENPP PVYSETEEQV IETITTPVHS ESSQPESNEL  120
VPEFCESWEC LKQEPEEEEM FRETADWNDN DLDLFREQEF SEFGKLQQNP EHCTVESGQD  180
SYVPWSNLLG SRKKGKKSQT KAEKTISLQV LRKYFSGSLK DAAKSIGVCP TTLKRICRQY  240
GINRWPSRKI KKVNHSLRKL QVVVDSVMGA QGLIEVDSFY TAFPELSSPN YSGHNPFSSF  300
KITDYSKESN PKPESHLFSP EGTDSKSQSS LSSPNSGLSI CHGQKHLTRT ANGSSTGHAS  360
AVEDPVEALK RTCSKSEINS LNQEEFARAK SHETLGQHQN LGTQARLAIS NSQGLQDGGA  420
FRVKATFGHE NIRFSLQANW GFSDLRREIA KRFDIYDFSR IGLKYLDNEH ESVLLTCDAD  480
LEECKDLLGF SQSRTIKITL YPVSIPILGS TFSSSRDLF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G293300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0562681e-46KX056268.1 Citrus trifoliata transcription factor NLP2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298777.30.0protein NLP1
RefseqXP_024452202.10.0protein NLP1
TrEMBLA0A2K2C5N60.0A0A2K2C5N6_POPTR; Uncharacterized protein
STRINGPOPTR_0001s30040.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2822633
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.13e-92Nin-like family protein