PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G284300.1
Common NamePOPTR_0001s29100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 60aa    MW: 6622.72 Da    PI: 11.0659
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G284300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF885e-281058250
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        ri+n++ rqvtfskRr g+lKKA+EL vLCdaev vi+fsstgkly+ +
  Potri.001G284300.1 10 RIDNSTSRQVTFSKRRSGLLKKAKELAVLCDAEVGVIVFSSTGKLYDHA 58
                        8*********************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.0E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.515160IPR002100Transcription factor, MADS-box
CDDcd002657.97E-36260No hitNo description
SuperFamilySSF554553.79E-27259IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-28323IPR002100Transcription factor, MADS-box
PfamPF003194.5E-261056IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRSGLLK KAKELAVLCD AEVGVIVFSS TGKLYDHANT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-19160160MEF2C
5f28_B1e-19160160MEF2C
5f28_C1e-19160160MEF2C
5f28_D1e-19160160MEF2C
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in roots, mostly in lateral roots (LR) primordia, young emerging LRs, apex and base of LRs, apex of the primary root, and in the stele. Barely detectable in shoots. {ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G284300.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2166766e-96AC216676.1 Populus trichocarpa clone POP046-B08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011030221.15e-36PREDICTED: agamous-like MADS-box protein AGL21 isoform X1
RefseqXP_011030222.14e-36PREDICTED: agamous-like MADS-box protein AGL21 isoform X2
SwissprotQ9SI384e-33ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBLA0A438F8571e-32A0A438F857_VITVI; MADS-box transcription factor ANR1
TrEMBLA0A438G0F51e-32A0A438G0F5_VITVI; MADS-box transcription factor ANR1
STRINGPOPTR_0001s29100.15e-36(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.12e-35AGAMOUS-like 44
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Yan Y,Wang H,Hamera S,Chen X,Fang R
    miR444a has multiple functions in the rice nitrate-signaling pathway.
    Plant J., 2014. 78(1): p. 44-55
    [PMID:24460537]
  3. Lei L, et al.
    Nitrogen use efficiency is regulated by interacting proteins relevant to development in wheat.
    Plant Biotechnol. J., 2018. 16(6): p. 1214-1226
    [PMID:29193541]
  4. Sun CH, et al.
    Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis.
    Plant Sci., 2018. 266: p. 27-36
    [PMID:29241564]