PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G281600.1
Common NamePOPTR_0001s28840g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 164aa    MW: 18138.8 Da    PI: 7.2697
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G281600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.23.3e-4461051100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l+++p ++r da+ slvyeA+ar+rdPvyG+vg i+ lq+q++ql+
  Potri.001G281600.1   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKIFGASNVSKMLQEIPIHQRADAVGSLVYEANARVRDPVYGCVGAISYLQNQVSQLQ 96 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          +la++++e
  Potri.001G281600.1  97 MQLAVAQAE 105
                         *****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9085106IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MAGSSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK IFGASNVSKM LQEIPIHQRA  60
DAVGSLVYEA NARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQQEPNLPTQ  120
LDQDDKSLLL ASCNNFNSIP QYFNFASSSN VIQDPLKRES LWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298499.11e-119LOB domain protein 12
SwissprotQ8LBW33e-85LBD12_ARATH; LOB domain-containing protein 12
TrEMBLB9GH621e-119B9GH62_POPTR; LOB domain protein 12
STRINGPOPTR_0001s28840.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-86LBD family protein