PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G280000.1
Common NamePOPTR_0001s28690g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 365aa    MW: 40494.9 Da    PI: 9.6253
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G280000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.93.1e-3062115255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrW p+LH +Fv+ave+LGG e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Potri.001G280000.1  62 PRLRWIPDLHLCFVQAVERLGGYERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 115
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-2858116IPR009057Homeodomain-like
PROSITE profilePS5129410.58458118IPR017930Myb domain
SuperFamilySSF466891.08E-1260116IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-2162117IPR006447Myb domain, plants
PfamPF002491.3E-663114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MKLGSDQKGD GLMMDASGKS KDGEGDNESK TKNSASSSNS IVDESEKASS SGVRPYVRSK  60
VPRLRWIPDL HLCFVQAVER LGGYERATPK LVLQLMNIKG LSIAHVKSHL QMYRSKKIDD  120
QGQVINSRGD LIGSSGYFSH NFWQHSLLPN IDHNRSSDFR SRSVSRSTGH GNWITSPSVL  180
VPDSMNIRSG AGFYNSISER IDGESGSSTR QGPFHTCNNS TFNDQRRKIK QEFLETESHQ  240
PMYNGNSIQG QISSTTKQPY FAAQFSKRGG DTYNESISLE TKWSFNAEKS NKAKRKADDL  300
DLSLSLSTRS KEKEVRRSLS WDEDDEGSNL SLSLSSTSTK ESNSIYLSMP SKYPKLASTL  360
DLTM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G280000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2103421e-79AC210342.1 Populus trichocarpa clone POP091-B06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299997.10.0probable transcription factor KAN2 isoform X2
TrEMBLB9GGQ90.0B9GGQ9_POPTR; Uncharacterized protein
STRINGPOPTR_0001s28690.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1655549
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-41G2-like family protein