PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G276800.5
Common NamePOPTR_0001s28350g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 525aa    MW: 58972.9 Da    PI: 8.2943
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G276800.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61e-182579357
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                        kRt  t+ q+ +Le+++++++yp++e++ eLA+++gLte+q++ WF+ rR k+k+
  Potri.001G276800.5 25 KRTVKTPAQVIALESFYNEHKYPTEEMKSELADRIGLTEKQISSWFCHRRLKDKR 79
                        8****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-21679IPR009057Homeodomain-like
SuperFamilySSF466892.74E-171381IPR009057Homeodomain-like
PROSITE profilePS5007116.6172080IPR001356Homeobox domain
SMARTSM003891.2E-182284IPR001356Homeobox domain
PfamPF000462.9E-162579IPR001356Homeobox domain
CDDcd000866.62E-172581No hitNo description
PROSITE patternPS0002705578IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MSAIFSESSE VHSEENRVSL EKNLKRTVKT PAQVIALESF YNEHKYPTEE MKSELADRIG  60
LTEKQISSWF CHRRLKDKRL KDEGYTNGRQ DRSSSILHDR GSGLRQDSCG STKQGDYRNI  120
DPREVESQRL YGQDFHTADL TYDRTSRYTG NVSGIDDISS GSSSSLQDKF VSQREDPYDT  180
ETSKYLAQNG ASMPLIPKGA ESFGYKPSGY LKVKGEIENA AITAVKMQLG RHYKEDGPPL  240
GVDFQSLPPS AFASPSRDPV NGPIYVGDLV GMRSPDVSGV RKQPSLSGRY EVYSTKMSSH  300
DSYTEGANCN PEHGSDSHER KSRHHLEQKS TYNVSNSNAG GNSTMDMPDD LAVETSVYRS  360
KRNYRTSSKH DFEGRRSDSF ATHHGPRGRR EKTEAWLHDC DNDNPKIARR NDYMSKPSHS  420
ILGPGKSLVT EERAPFTKTE KEEKLYGEMK RMKGSHDSVR VKRHPRDETA VAKRFRADFP  480
RQEHVTKASV SGMRRRTNLT EGSVMERPSS FSEDETAETS SSAE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G276800.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024447339.10.0homeobox-DDT domain protein RLT1 isoform X1
TrEMBLA0A2K2C4R80.0A0A2K2C4R8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s28350.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.13e-88HB-other family protein