PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G276800.3
Common NamePOPTR_0001s28350g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 499aa    MW: 56251 Da    PI: 9.0265
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G276800.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.79.7e-192175357
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                        kRt  t+ q+ +Le+++++++yp++e++ eLA+++gLte+q++ WF+ rR k+k+
  Potri.001G276800.3 21 KRTVKTPAQVIALESFYNEHKYPTEEMKSELADRIGLTEKQISSWFCHRRLKDKR 75
                        8****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-21275IPR009057Homeodomain-like
PROSITE profilePS5007116.6171676IPR001356Homeobox domain
SMARTSM003891.2E-181880IPR001356Homeobox domain
SuperFamilySSF466893.17E-171982IPR009057Homeodomain-like
CDDcd000867.68E-172177No hitNo description
PfamPF000462.7E-162175IPR001356Homeobox domain
PROSITE patternPS0002705174IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 499 aa     Download sequence    Send to blast
MEESSEVHSE ENRVSLEKNL KRTVKTPAQV IALESFYNEH KYPTEEMKSE LADRIGLTEK  60
QISSWFCHRR LKDKRLKDEG YTNGRQDRSS SILHDRGSGL RQDSCGSTKQ GDYRNIDPRE  120
VESQRLYGQD FHTADLTYDR TSRYTGNVSG IDDISSGSSS SLQDKFVSQR EDPYDTETSK  180
YLAQNGASMP LIPKGAESFG YKPSGYLKVK GEIENAAITA VKMQLGRHYK EDGPPLGVDF  240
QSLPPSAFAS PSRDPVNGPI YVGDLVGMRS PDVSGVRKQP SLSGRYEVYS TKMSSHDSYT  300
EGANCNPEHG SDSHERKSRH HLEQKSTYNV SNSNAGGNST MDMPDDLAVE TSVYRSKRNY  360
RTSSKHDFEG RRSDSFATHH GPRGRREKTE AWLHDCDNDN PKIARRNDYM SKPSHSILGP  420
GKSLVTEERA PFTKTEKEEK LYGEMKRMKG SHDSVRVKRH PRDETAVAKR FRADFPRQEH  480
VTKASVSGMR RRTNLTEG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G276800.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024447339.10.0homeobox-DDT domain protein RLT1 isoform X1
TrEMBLA0A2I4KKT90.0A0A2I4KKT9_POPTR; HB-other family protein
STRINGPOPTR_0001s28350.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.15e-88HB-other family protein