PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G251400.1
Common NamePOPTR_0001s25850g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 203aa    MW: 22918 Da    PI: 7.2379
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G251400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.21.1e-181561147
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                        krien+  r +tfskRr gi KKA+EL +L++ae+a+ +fs+ gk +
  Potri.001G251400.1 15 KRIENQDDRLITFSKRRSGIYKKASELATLTGAEIAIAVFSPAGKPF 61
                        79*****************************************9855 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.6E-27766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.137767IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.06E-25878IPR002100Transcription factor, MADS-box
CDDcd002654.98E-31879No hitNo description
PRINTSPR004042.3E-18929IPR002100Transcription factor, MADS-box
PfamPF003191.4E-211663IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-182944IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-184465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MASKKTKGRQ KVEMKRIENQ DDRLITFSKR RSGIYKKASE LATLTGAEIA IAVFSPAGKP  60
FSFGHPSVES VINRFLEDPL DMDSTYHLVE AHRRMRIEEL TQKHNDMQHQ LDEEKEKGLK  120
LKSKIKEMDS KGWWDTAVDE LNIQELIELE KKFKELQMTL CSKIAENAST VASSSQAPEI  180
GHSFASTTVN DQNAPGFPDK NH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G251400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298313.11e-150agamous-like MADS-box protein AGL62
TrEMBLB9GII01e-148B9GII0_POPTR; Uncharacterized protein
STRINGPOPTR_0001s25850.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.19e-32AGAMOUS-like 62