PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G243600.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 347aa    MW: 38664.8 Da    PI: 6.8845
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G243600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.24.4e-29122175155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv++v +L G ++A+Pkti++ m+v+gLt+e+v+SHLQkYRl
  Potri.001G243600.2 122 RPRLVWTPQLHKRFVDVVGHL-GMKNAVPKTIMQWMNVEGLTRENVASHLQKYRL 175
                         59*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.81E-19119179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28121179IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-22123175IPR006447Myb domain, plants
PfamPF002497.5E-7125174IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGEEVKMSEY EINDEDNINR DDERIDVWEM GLPTPYDLTP LSQLLIPPEL ASAFNISPEP  60
HRTPLDVNRA SQNTLSNLHG HLNALSSNNF KSFNETTEAD SALRTENWVD DPSSAAARTL  120
KRPRLVWTPQ LHKRFVDVVG HLGMKNAVPK TIMQWMNVEG LTRENVASHL QKYRLYLKRK  180
QGLSSEGPSA SDQLFASTPV PQSLHESGGG SCGGGNFGMP IPMPYHHPAT TAGGMMPMPV  240
YGHMGIQMVN DHVHNNNNSN NYQHQQVSMN SHQNGYNGNV ALLMGNKHVH NSSNKHQHQQ  300
VSTNSHQNGY NGNVAYGHMF QQRDWNGTNY GPYSHHPHHA VSNDNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-31122178157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is essential for the generation of the circadian clock oscillation. Is necessary for activation of CCA1 and LHY expression. Is coregulated with TOC1 and seems to be repressed by CCA1 and LHY by direct binding of these proteins to the evening element in the LUX promoter. Directly regulates the expression of PRR9, a major component of the morning transcriptional feedback circuit, by binding specific sites on PRR9 promoter. Binds to its own promoter, inducing a negative auto-regulatory feedback loop within the core clock. Binds to ELF3 and associates with ELF4 in a diurnal complex which is required for the expression of the growth-promoting transcription factors PIF4 and PIF5 and subsequent hypocotyl growth in the early evening. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:21236673, ECO:0000269|PubMed:21753751, ECO:0000269|PubMed:22311777}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G243600.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:17132630, ECO:0000269|PubMed:21753751}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2158500.0AC215850.1 Populus trichocarpa clone POP025-N09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024450865.10.0transcription factor BOA
SwissprotQ9SNB41e-77PCL1_ARATH; Transcription factor LUX
TrEMBLA0A2K2C2Z10.0A0A2K2C2Z1_POPTR; Uncharacterized protein
STRINGPOPTR_0001s25040.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.38e-76G2-like family protein
Publications ? help Back to Top
  1. Higham CF,Husmeier D
    A Bayesian approach for parameter estimation in the extended clock gene circuit of Arabidopsis thaliana.
    BMC Bioinformatics, 2013. 14 Suppl 10: p. S3
    [PMID:24267177]