PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G241900.1
Common NamePOPTR_0001s24870g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 658aa    MW: 74098 Da    PI: 5.5535
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G241900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS352.66.1e-1082856552374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++ Aeav+ +d++ a++lL++++++++p gd  qRla++f++AL++r+a+++se+y++l++++ +    +  l+a +l+  ++P++ 
  Potri.001G241900.1 285 RTLLIHSAEAVAVNDHRTATELLTQIRQHSTPFGDGSQRLAHCFANALETRIAGTGSEVYATLAAKRVT---AACILKAGRLYISACPFMI 372
                         789************************************************************999998...8999*************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +s++ a q I++ +e+++r+Hii f+i +G+ Wp+L+q L++Rp+gpp l iTg++ +++g  s+  le +g+ La+++e+++vpf++n+ 
  Potri.001G241900.1 373 MSNFFAEQNIMDLAENATRLHIIHFGILYGFPWPSLIQRLSTRPSGPPVLCITGIECSQTGyeSAAVLEDIGRYLASYCEKFNVPFNYNA- 462
                         *********************************************************9999999**************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +++++e+++le+L+++++E+++V++ ++ ++llde+v+l+ +rd+vL+l+k+++P ++++   +  +ns+ F+ rf eal yys+lfd+le
  Potri.001G241900.1 463 ISQKWENVQLEDLKIDRDEVTVVSSLYRFQHLLDETVALNCQRDAVLNLIKRINPAIFIHGIINGAYNSPFFVSRFREALFYYSSLFDMLE 553
                         7****************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         a+ +re+ er++ E+e++g+ei nv++ceg +r er e++++W++r  +aG++++pl+e ++kq++  ++  + + + ++++ +++++gWk
  Potri.001G241900.1 554 ANTAREDPERMVFEQEVFGKEILNVISCEGWDRLERPEKYKQWQARNARAGLRQLPLKEGIMKQVREQVKSSYHKDFLMDQDGQWMLQGWK 644
                         *************************************************************************888*************** PP

                GRAS 364 drpLvsvSaWr 374
                         +r L+++S+W+
  Potri.001G241900.1 645 GRILFAISCWK 655
                         **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.617258635IPR005202Transcription factor GRAS
PfamPF035142.1E-105285655IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MNPVFEDPTA NAVLKYISQI LMEEESEEQT FVPRDFSLRA AERPFSDILA PEGSSSDGKV  60
SDPNQTINNV STYCCDVYGC NSSMKANNIV ASSSICDGGA PPVNYTVPLC LQVNPPPFFP  120
RSVFRTFPGP VDSVNVALKE RQLEVLFRGG TDETWKFHQQ PNEMVVDFAN NRVTPVMAIT  180
KESNLDHSVC ELMERQNHYR VETELQPRIN KHTSIYAEEA QQFGMFAGVF PSTGGDGEPA  240
GFNLNEAFQS GPGMISYLKE QSRGSNDGVI CRKNEVRSRE LVDMRTLLIH SAEAVAVNDH  300
RTATELLTQI RQHSTPFGDG SQRLAHCFAN ALETRIAGTG SEVYATLAAK RVTAACILKA  360
GRLYISACPF MIMSNFFAEQ NIMDLAENAT RLHIIHFGIL YGFPWPSLIQ RLSTRPSGPP  420
VLCITGIECS QTGYESAAVL EDIGRYLASY CEKFNVPFNY NAISQKWENV QLEDLKIDRD  480
EVTVVSSLYR FQHLLDETVA LNCQRDAVLN LIKRINPAIF IHGIINGAYN SPFFVSRFRE  540
ALFYYSSLFD MLEANTARED PERMVFEQEV FGKEILNVIS CEGWDRLERP EKYKQWQARN  600
ARAGLRQLPL KEGIMKQVRE QVKSSYHKDF LMDQDGQWML QGWKGRILFA ISCWKSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-432886558375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2725000.0GU272500.1 Populus balsamifera isolate WHR03 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724990.0GU272499.1 Populus balsamifera isolate WHR03 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724980.0GU272498.1 Populus balsamifera isolate STO11 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724970.0GU272497.1 Populus balsamifera isolate STO11 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724960.0GU272496.1 Populus balsamifera isolate STL13 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724950.0GU272495.1 Populus balsamifera isolate STL13 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724940.0GU272494.1 Populus balsamifera isolate RNA13 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724930.0GU272493.1 Populus balsamifera isolate RNA13 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724920.0GU272492.1 Populus balsamifera isolate NWL07 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724910.0GU272491.1 Populus balsamifera isolate NWL07 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724900.0GU272490.1 Populus balsamifera isolate LOV02 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724890.0GU272489.1 Populus balsamifera isolate LOV02 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724880.0GU272488.1 Populus balsamifera isolate HAY07 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724870.0GU272487.1 Populus balsamifera isolate HAY07 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724860.0GU272486.1 Populus balsamifera isolate FBK13 haplotype B scarecrow-like transcription factor 9 gene, partial sequence.
GenBankGU2724850.0GU272485.1 Populus balsamifera isolate FBK13 haplotype A scarecrow-like transcription factor 9 gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299865.10.0hypothetical protein POPTR_0001s24870g
TrEMBLB9GJL80.0B9GJL8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s24870.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-168SCARECROW-like 14