PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G241800.1
Common NamePOPTR_0001s24860g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 796aa    MW: 89264.6 Da    PI: 4.7687
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G241800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS374.71.2e-1144187921373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL+ cA+avs++d++ a++lL+++++++s+ gd +qRla++f+++L+arla+s++++ + ++  ++++++ ++ l+a+k+  +++P+ 
  Potri.001G241800.1 418 LRTLLILCAQAVSANDFRTANELLKQIRQHSSQFGDGTQRLAHFFANGLEARLAGSGDGTRSFFTHLASKRTTAADMLKAYKTNLQACPFK 508
                         5789*************************************************************************************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kfs + a ++Il+a+e+++++Hi+Df++ +G+QWp L+q+L+  p+gpp+lR+Tg++ p++g   +e++eetg+rLak++e+++vpfe+n+
  Potri.001G241800.1 509 KFSIFFAISMILQAAEKASTLHIVDFGVLYGFQWPILIQQLSLLPNGPPKLRLTGIELPQHGfrPSERIEETGRRLAKYCERFKVPFEYNP 599
                         *************************************************************9***************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         ++a+++e + +e+L+++++E+laV+++ + ++l+de+v+++ +++++L+l+++++P+++v++  + ++n++ Fl+rf eal ++s+lfd++
  Potri.001G241800.1 600 IAAQNWERIPIEDLKINRNEVLAVHCQCRFKNLFDETVEVDCPKNAILNLIRKMNPDIFVHTIINGSYNAPFFLTRFREALFHFSSLFDMF 690
                         ******************************************************************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +++lpre+++ri+ E el gr+++nvvaceg+er+er et+++W++r  +aGFk++pl++k +++ +  l++++ + + ++e+++++++gW
  Potri.001G241800.1 691 DSTLPREDQARIMFEGELYGRDAMNVVACEGQERVERPETYKQWQARTVRAGFKTLPLEQKLMTKFRGKLKTYYHKDFVIDEDNDWMLQGW 781
                         **************************************************************************889************** PP

                GRAS 363 kdrpLvsvSaW 373
                         k+r +++ S+W
  Potri.001G241800.1 782 KGRIIYASSCW 792
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.001392773IPR005202Transcription factor GRAS
PfamPF035144.2E-112418792IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 796 aa     Download sequence    Send to blast
MDQNYTGLHD RFQNDSKFDE TIMLPNSEQY PNIEHGLEFN IPSPDLSFMN LPFDPPDTDP  60
DRFGLSFNSS PGVESFVPSM SLSPDGEALD PSSAWSPEAE ASSPSEDSDS SDPLLKYISQ  120
MLMEENMEDQ PHMFHDHFAL STTEKSLYDV LGEQYPSSLD SPESYVNLES PDSIFLASGS  180
NCGDNTSKST STGTTSGTID SAKETQWVGG DVGGMNPSFS RTPLPDDNHL HSNFQPNVQF  240
TGNPSNGFTD TGDGLMGSSA GEMVQNMFSD AESVLQFKRG LEEASKFLPI ASQLVIDLET  300
NAVSSRQKED APIVVVKEEN SERDSSPDGS RGRKNHERED PDLEEGRRNK QSAVHVEESE  360
LSEMFDKVLL WTGGQCCGDD AVQDVASKNS QPDEQSNGSS GGKTRAKRQN KKKETVDLRT  420
LLILCAQAVS ANDFRTANEL LKQIRQHSSQ FGDGTQRLAH FFANGLEARL AGSGDGTRSF  480
FTHLASKRTT AADMLKAYKT NLQACPFKKF SIFFAISMIL QAAEKASTLH IVDFGVLYGF  540
QWPILIQQLS LLPNGPPKLR LTGIELPQHG FRPSERIEET GRRLAKYCER FKVPFEYNPI  600
AAQNWERIPI EDLKINRNEV LAVHCQCRFK NLFDETVEVD CPKNAILNLI RKMNPDIFVH  660
TIINGSYNAP FFLTRFREAL FHFSSLFDMF DSTLPREDQA RIMFEGELYG RDAMNVVACE  720
GQERVERPET YKQWQARTVR AGFKTLPLEQ KLMTKFRGKL KTYYHKDFVI DEDNDWMLQG  780
WKGRIIYASS CWVPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-384227928374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2089320.0AC208932.1 Populus trichocarpa clone JGIACSB1081-D10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011035288.10.0PREDICTED: scarecrow-like protein 34
RefseqXP_011035289.10.0PREDICTED: scarecrow-like protein 34
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLU5GV890.0U5GV89_POPTR; Uncharacterized protein
STRINGPOPTR_0001s24860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14