PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G238400.2
Common NamePOPTR_0001s24540g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 323aa    MW: 34422.4 Da    PI: 9.854
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G238400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.46.5e-3867127262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +e alkcprC+stntkfCy+nny+lsqPr+fCk+CrryWt+GGalr vPvGgg+r+nkk++
  Potri.001G238400.2  67 PEVALKCPRCESTNTKFCYFNNYNLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKKRK 127
                         56789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3451120IPR003851Zinc finger, Dof-type
PfamPF027014.5E-3270125IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.37671125IPR003851Zinc finger, Dof-type
PROSITE patternPS01361073109IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MVFSSVPFYL DPPNWQQQPS QQPGASNESP QLPPLPPPTH VGGSGTAGTI RPGSMADRAR  60
LAKIPQPEVA LKCPRCESTN TKFCYFNNYN LSQPRHFCKT CRRYWTRGGA LRSVPVGGGC  120
RRNKKRKVQS SSKSPVSSER QVGSTSSSTS ALPSQVIGHL PQQQSQLPYM TSLHNLAQFG  180
EGNIGLNFGG IQGQLGSTSG ASGQTDMGFQ IGSNSGMNSS AILSAGGVHQ FPFFEFSPAG  240
LYPLQSEGAE TPISVHGDNQ LQSMTSSSRV SQLAPVKTEG NQGLNLSKPY LGAPQNNQYY  300
WGGNTWADLS GLNSSSTSHL LR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120126RRNKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G238400.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024460176.10.0dof zinc finger protein DOF2.2 isoform X2
TrEMBLA0A2K2C2N40.0A0A2K2C2N4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s24540.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.24e-46Dof family protein