PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G238400.1
Common NamePOPTR_0001s24540g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 333aa    MW: 35591.7 Da    PI: 9.854
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G238400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.36.8e-3877137262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +e alkcprC+stntkfCy+nny+lsqPr+fCk+CrryWt+GGalr vPvGgg+r+nkk++
  Potri.001G238400.1  77 PEVALKCPRCESTNTKFCYFNNYNLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKKRK 137
                         56789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3461130IPR003851Zinc finger, Dof-type
PfamPF027014.7E-3280135IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.37681135IPR003851Zinc finger, Dof-type
PROSITE patternPS01361083119IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MVFSSVPFYL DPPNWQQQPL NFSILQQQPS QQPGASNESP QLPPLPPPTH VGGSGTAGTI  60
RPGSMADRAR LAKIPQPEVA LKCPRCESTN TKFCYFNNYN LSQPRHFCKT CRRYWTRGGA  120
LRSVPVGGGC RRNKKRKVQS SSKSPVSSER QVGSTSSSTS ALPSQVIGHL PQQQSQLPYM  180
TSLHNLAQFG EGNIGLNFGG IQGQLGSTSG ASGQTDMGFQ IGSNSGMNSS AILSAGGVHQ  240
FPFFEFSPAG LYPLQSEGAE TPISVHGDNQ LQSMTSSSRV SQLAPVKTEG NQGLNLSKPY  300
LGAPQNNQYY WGGNTWADLS GLNSSSTSHL LR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130136RRNKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G238400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024460176.10.0dof zinc finger protein DOF2.2 isoform X2
TrEMBLA0A3S9LK650.0A0A3S9LK65_POPTO; Dof-type zinc finger DNA-binding family protein
STRINGPOPTR_0001s24540.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.12e-48OBF-binding protein 3