PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G237900.1
Common NamePOPTR_0001s24470g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 246aa    MW: 27882.2 Da    PI: 8.4647
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G237900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.72.7e-201372357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        +R+++tkeq+  Le+++ +  r+ps+e++e++A++l    +++ ++V++WFqN++a++++
  Potri.001G237900.1 13 SRWSPTKEQISMLESFYSQgIRTPSTEMIEQIASRLkaygHIEGKNVFYWFQNHKARQRQ 72
                        7*****************99**************************************97 PP

2Wus_type_Homeobox108.15.2e-351274365
   Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        ++RW+Pt+eQi +Le+ y++G+rtP++e i++i+++L++yG+ie+kNVfyWFQN+kaR+rqkq
  Potri.001G237900.1 12 NSRWSPTKEQISMLESFYSQGIRTPSTEMIEQIASRLKAYGHIEGKNVFYWFQNHKARQRQKQ 74
                        79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.531873IPR001356Homeobox domain
SMARTSM003897.9E-71077IPR001356Homeobox domain
SuperFamilySSF466899.84E-141279IPR009057Homeodomain-like
PfamPF000464.1E-181372IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.9E-101372IPR009057Homeodomain-like
CDDcd000861.91E-71474No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MDVSSSGGAS VNSRWSPTKE QISMLESFYS QGIRTPSTEM IEQIASRLKA YGHIEGKNVF  60
YWFQNHKARQ RQKQKQENMA YINKYLHKAH QPVFAPPCRN VVNSPCYLPK SDIMGLCQQH  120
QNMLLPGNFK RRSRSETISY AFKGYDQEAV LREYHNHITK NKFERSPVTI DKSSSDQETL  180
PLFPLHPTGI LEGASPIFSH GSTSAENSIN TPISSEITHG IGEHSADHKP FFDFFSEKDP  240
FESSH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G237900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827010.0KF982701.1 Populus tomentosa WOX2a (WOX2a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011000265.11e-175PREDICTED: WUSCHEL-related homeobox 2-like
TrEMBLB9GJQ10.0B9GJQ1_POPTR; Uncharacterized protein
STRINGPOPTR_0001s24470.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Representative plantOGRP85821116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-51WUSCHEL related homeobox 2