PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G229700.2
Common NamePOPTR_0001s23680g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 260aa    MW: 28946.1 Da    PI: 8.3826
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G229700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45.1e-1878132256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++k+q   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Potri.001G229700.2  78 RKKLRLSKDQSAFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTK 132
                         788899***********************************************98 PP

2HD-ZIP_I/II128.13.6e-4178168192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlsk+q+++LEesF+e+++L+p++K +la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Potri.001G229700.2  78 RKKLRLSKDQSAFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-AL 167
                         69*************************************************************************************9.55 PP

         HD-ZIP_I/II  92 k 92 
                         k
  Potri.001G229700.2 168 K 168
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.15174134IPR001356Homeobox domain
SuperFamilySSF466893.34E-1876143IPR009057Homeodomain-like
SMARTSM003893.7E-1676138IPR001356Homeobox domain
CDDcd000864.07E-1578135No hitNo description
PfamPF000462.0E-1578132IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-1778132IPR009057Homeodomain-like
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
SMARTSM003409.1E-26134177IPR003106Leucine zipper, homeobox-associated
PfamPF021833.5E-11134168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MSRGFDVNRF PAVMVHEDQA DQDVAALSSS PPNSATSSFQ MDFCMYSSKG RSESHNEADQ  60
AERASSRASD EDENGSARKK LRLSKDQSAF LEESFKEHNT LTPKQKLALA KELNLRPRQV  120
EVWFQNRRAR TKLKQTEVDC EYLKRCCETL TEENRRLHKE LQELRALKTS NPFYMQLPAT  180
TLTMCPSCER VATTSTSTAA ATTTTATPTA TAATTTTTTN NQNNTADPTS KTTGLSLGST  240
RPRFYPFSHT QTHPHQHTA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126134RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.155780.0leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G229700.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1473520.0EF147352.1 Populus trichocarpa clone WS0122_O02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006369464.20.0homeobox-leucine zipper protein HOX11
SwissprotP466655e-92HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2K2C2640.0A0A2K2C264_POPTR; Uncharacterized protein
TrEMBLA0A2K2C2720.0A0A2K2C272_POPTR; Uncharacterized protein
STRINGPOPTR_0001s23680.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-83homeobox from Arabidopsis thaliana