PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G229700.1
Common NamePOPTR_0001s23680g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 375aa    MW: 41439.8 Da    PI: 7.8463
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G229700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.69.2e-18193247256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++k+q   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Potri.001G229700.1 193 RKKLRLSKDQSAFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTK 247
                         778899***********************************************98 PP

2HD-ZIP_I/II127.17.4e-41193283192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlsk+q+++LEesF+e+++L+p++K +la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +l
  Potri.001G229700.1 193 RKKLRLSKDQSAFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-AL 282
                         69*************************************************************************************9.55 PP

         HD-ZIP_I/II  92 k 92 
                         k
  Potri.001G229700.1 283 K 283
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.151189249IPR001356Homeobox domain
SMARTSM003893.7E-16191253IPR001356Homeobox domain
SuperFamilySSF466896.42E-18191258IPR009057Homeodomain-like
CDDcd000861.39E-15193250No hitNo description
Gene3DG3DSA:1.10.10.602.0E-17193247IPR009057Homeodomain-like
PfamPF000463.5E-15193247IPR001356Homeobox domain
PROSITE patternPS000270224247IPR017970Homeobox, conserved site
PfamPF021835.8E-11249283IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.1E-26249292IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MELGLSLGDA ATASKPFGFM EKSTKLTNKA SLGFCMGLSI GQNHTPREDE DKEKHGNNDH  60
KSDNTNTTTT AEANKRKSLT VDTTDSPIQL DLLPNTPVPR NRNSSPTYVV YDNGNMSRGF  120
DVNRFPAVMV HEDQADQDVA ALSSSPPNSA TSSFQMDFCM YSSKGRSESH NEADQAERAS  180
SRASDEDENG SARKKLRLSK DQSAFLEESF KEHNTLTPKQ KLALAKELNL RPRQVEVWFQ  240
NRRARTKLKQ TEVDCEYLKR CCETLTEENR RLHKELQELR ALKTSNPFYM QLPATTLTMC  300
PSCERVATTS TSTAAATTTT ATPTATAATT TTTTNNQNNT ADPTSKTTGL SLGSTRPRFY  360
PFSHTQTHPH QHTA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1241249RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.155780.0leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G229700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1473520.0EF147352.1 Populus trichocarpa clone WS0122_O02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006369464.20.0homeobox-leucine zipper protein HOX11
SwissprotP466651e-99HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2K2C2640.0A0A2K2C264_POPTR; Uncharacterized protein
STRINGPOPTR_0001s23680.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-89homeobox from Arabidopsis thaliana