PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G229300.1
Common NamePOPTR_0001s23640g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 643aa    MW: 71166.6 Da    PI: 9.3278
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G229300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.49.3e-101447236
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS- CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRt 36
                        ++W t+E++ll+ avk++G ++W+++a +++ ++t
  Potri.001G229300.1 14 QSWGTWEELLLASAVKRHGFKNWDSVALELQ-TKT 47
                        68*****************************.665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-41147IPR009057Homeodomain-like
SMARTSM007175.2E-41269IPR001005SANT/Myb domain
PfamPF002497.5E-91447IPR001005SANT/Myb domain
CDDcd001672.27E-51548No hitNo description
SMARTSM002977.0E-14281390IPR001487Bromodomain
SuperFamilySSF473702.62E-14294394IPR001487Bromodomain
Gene3DG3DSA:1.20.920.102.0E-12295389IPR001487Bromodomain
PROSITE profilePS5001411.105300371IPR001487Bromodomain
PfamPF004392.1E-8300371IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MANQEEDIHH QNQQSWGTWE ELLLASAVKR HGFKNWDSVA LELQTKTCLP HLLTTAQICQ  60
QKYLDLNRRF NTTTINNLHH NHTPEEDNQD EEQNNINTDI INNNIVSVPW LEELRKLRVA  120
ELKQEVQRYD VSILTLQLKV KKLEEEREIS VQEGDGNTEK PDLKADRLIN EDEPGKPGSV  180
SGEESDPEDR SVNESNSTAS GGGEDAVAKL EEVEPVQGGS GEPDPVVSGS NRKALDEGGG  240
GGGEESCEFG DSVTQLSCES LNSGRKRKGS ERKEEVSVTG GEETVAVKSE PVVGFLEMIR  300
AHRNGSLFES LLESQEMGVY KDMIRQHMDL EAIQAKLEQG SYSLSKLLFF RDLLLLFNNA  360
LVFFPKHSVE SLTAHKIRSL VMDEMRKDTQ KSDSTVVPEN IPSQPKRELE RSDSLLAKHK  420
SSIPIIVCRK RSSISAKPSS SSLGPKIEQQ QQQSNENKPV NDLKPPAVEQ GLLKMKSEEK  480
PVTGARSTRR GNKNLAKGST SPSKKQNTSP DTKVAAPDKS ETPKTEKKKN EALPLEKKKS  540
AVDFLKRIKK NSPAETPKNN NRGASSGGER KMEGSGGKGE RGKERVLKNS DKKQGKQESS  600
PSKKNVGRPS KKAAEESRVS GKRGRDSGGK EVAKRPRKRS RR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1633641KRPRKRSRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G229300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024446167.10.0muscle M-line assembly protein unc-89 isoform X1
TrEMBLA0A3N7FYD70.0A0A3N7FYD7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s23640.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18702972
Representative plantOGRP38051123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44430.12e-95DNA-binding bromodomain-containing protein