PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G228500.1
Common NamePOPTR_0001s23560g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 271aa    MW: 29920.8 Da    PI: 10.0629
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G228500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like986.6e-31203257155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k r+rWt++LH+rFve v++LGG+ekAtPk il+ m+v+gLt+ hvkSHLQkYR+
  Potri.001G228500.1 203 KIRVRWTQDLHKRFVESVNRLGGAEKATPKGILREMDVHGLTILHVKSHLQKYRT 257
                         569***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.216200260IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-27201257IPR009057Homeodomain-like
SuperFamilySSF466893.58E-16201257IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-24203257IPR006447Myb domain, plants
PfamPF002499.9E-8205256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MASDGNMGFC FQFNLPVLHE GSIPKFSPGT SSTPSAPIIS SHFASSASAP YAPEGYKGLS  60
CDTSSLSTCS PVGKTQCSVV NPQNSILDLK SSVNLINLHN NQDPRSTENT YQDLYRNLSG  120
SSLFPPILQK SANKLAALNR RKMHVDNRFK DHQNHEVAYQ PFTSQVTKPT SHFQPQKQPA  180
YSPYDMTSGA NNSVSLGATI KRKIRVRWTQ DLHKRFVESV NRLGGAEKAT PKGILREMDV  240
HGLTILHVKS HLQKYRTVRY LPESKEGIFT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-23203260259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-23203260259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-23203260158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-23203260158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-23203260158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-23203260158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-23203260259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-23203260259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-23203260259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-23203260259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-23203260259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-23203260259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G228500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006369451.20.0myb family transcription factor PHL5 isoform X3
RefseqXP_024448738.10.0myb family transcription factor PHL5 isoform X1
RefseqXP_024448741.10.0myb family transcription factor PHL5 isoform X2
TrEMBLA0A3N7EBF70.0A0A3N7EBF7_POPTR; Uncharacterized protein
TrEMBLA0A3N7EDN90.0A0A3N7EDN9_POPTR; Uncharacterized protein
TrEMBLA0A3N7FU150.0A0A3N7FU15_POPTR; Uncharacterized protein
STRINGPOPTR_0001s23560.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1787557
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.26e-33G2-like family protein