PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G214900.1
Common NamePOPTR_0001s22220g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 337aa    MW: 38304.1 Da    PI: 9.3317
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G214900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.91.7e-151151343
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                        i n++ r +t+ kR++g+ KKA E  +LC+++++vii++++
  Potri.001G214900.1 11 IRNERSRMITYHKRKKGLTKKAREFQILCGVDACVIILGPK 51
                        89************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.4E-14164IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.11151IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.8E-18177IPR002100Transcription factor, MADS-box
CDDcd002666.33E-19279No hitNo description
PRINTSPR004044.5E-8323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRGKLTMEL IRNERSRMIT YHKRKKGLTK KAREFQILCG VDACVIILGP KLNNHPVDVE  60
TWPTDRIEVR RIINRFRSEG TDRKKTQDLS YFFEARKKKL DDEIAKLRKA CMEAKFPAWD  120
NRLNLLSLEQ LRVLAGVFES KLDVARGWIL KLKGNPFLME DSKSGINAAG SISDKSSFLA  180
SSTLANALLP KNIELEALNH QPFSCAKPID MPLATCYPSH QLQQMLPFNV NPINSPMLMM  240
MNHEDFGQFG GLSSSSTIKS TVQYNYDPAT EMIGNMMFNN PSWELSASYH GPSRQPIFPY  300
RQGPMTQNVS SQLCIPQFSY FFDVNELEMN RTENFG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18298RKKTQDLSYFFEARKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G214900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1840820.0AC184082.2 Populus trichocarpa clone Pop1-55P2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298260.30.0agamous-like MADS-box protein AGL27
TrEMBLA0A2K2C1G80.0A0A2K2C1G8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s22220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Representative plantOGRP3677621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-23M-type_MADS family protein