PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G214700.7
Common NamePOPTR_0001s22180g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family YABBY
Protein Properties Length: 207aa    MW: 22974.1 Da    PI: 9.5896
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G214700.7genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY184.36.7e-573417317170
               YABBY  17 fCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenede 107
                         f n    vsvPs+slf++vtvrCGhC +llsvn+  + q+l+ ++      ++ ll + ++ ++n+ s     ++ ++ +     se++++
  Potri.001G214700.7  34 FTNSSWQVSVPSSSLFNIVTVRCGHCGNLLSVNMGASLQTLPLQDP-----QKLLLINSEDLNKNFGSS----SKCNKVT----ASESTEH 111
                         7888899***********************************9996.....223344444444444432....2222222....2566778 PP

               YABBY 108 evprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                         e pr+p +irPPekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
  Potri.001G214700.7 112 EPPRMP-AIRPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 173
                         888865.5*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.9E-6033173IPR006780YABBY protein
SuperFamilySSF470952.09E-8116166IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.1E-5121167IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0010158Biological Processabaxial cell fate specification
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MLARVLLKFE ANYTFGSIQV ISCDNTRRAF LSCFTNSSWQ VSVPSSSLFN IVTVRCGHCG  60
NLLSVNMGAS LQTLPLQDPQ KLLLINSEDL NKNFGSSSKC NKVTASESTE HEPPRMPAIR  120
PPEKRQRVPS AYNRFIKEEI QRIKASNPDI SHREAFSTAA KNWAHFPHIH FGLKLDSNKH  180
AKLDHQSFAG EGTQKTSGLY EINGSL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.2630.0bud| catkin| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269|PubMed:10457020}.
UniprotTISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269|PubMed:10457020}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G214700.7
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1474020.0EF147402.1 Populus trichocarpa clone WS01230_J05 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299655.31e-121axial regulator YABBY 5 isoform X2
SwissprotQ9XFB03e-62YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLA0A2K2C1G21e-120A0A2K2C1G2_POPTR; Uncharacterized protein
STRINGPOPTR_0001s22180.11e-153(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.13e-60YABBY family protein
Publications ? help Back to Top
  1. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]