PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G189800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 374aa    MW: 40555.2 Da    PI: 7.728
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G189800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.84.9e-13110154347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qk+
  Potri.001G189800.1 110 PWTEEEHRLFLIGLQKLGKGDWRGIARNFVVSRTPTQVASHAQKF 154
                         8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.306103159IPR017930Myb domain
SuperFamilySSF466891.72E-16105160IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-18106158IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.2E-11107150IPR009057Homeodomain-like
SMARTSM007178.2E-10107157IPR001005SANT/Myb domain
PfamPF002494.7E-10110153IPR001005SANT/Myb domain
CDDcd001671.26E-8110155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RSSLASSSSS PLSGVKLFGV RLTDGSIIKK SASMGNLSAH  60
YHSSSSAAAS PNPDSPVSDR VHDDGYLSDD PAAHASCSTS RRGDRKKGVP WTEEEHRLFL  120
IGLQKLGKGD WRGIARNFVV SRTPTQVASH AQKFFIRQSN ATRRKRRSSL FDMVPEMATD  180
PQPVPEEQEL PSSQAGDDDN VDALPSLNLS LKPEFEPMDT ESQELVKERD KTVMGFSEFK  240
PSVPSSSEFV PIVSGSNEFT AVPGFFPAYM PVPYPYWAPN TTPFEEGKGA ATSHHEVLKP  300
VPSILKEPFN VDELVGMSHL SLGEIERRHR EPSPLSLKLI GEAPRQSAFH ASAPASGSDL  360
SNGKASGTKR LNS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.61930.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G189800.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1482410.0EF148241.1 Populus trichocarpa x Populus deltoides clone WS01312_B18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024449520.10.0transcription factor MYBS3 isoform X1
RefseqXP_024449521.10.0transcription factor MYBS3 isoform X1
SwissprotQ7XC573e-96MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBLA0A2K2C0380.0A0A2K2C038_POPTR; Uncharacterized protein
STRINGPOPTR_0001s19070.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-102MYB_related family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Su CF, et al.
    A novel MYBS3-dependent pathway confers cold tolerance in rice.
    Plant Physiol., 2010. 153(1): p. 145-58
    [PMID:20130099]