PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G188500.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 201aa    MW: 22207 Da    PI: 9.4158
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G188500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.63.5e-18116150135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +Cg+ kTp+WR gp g+ktLCnaCG++y++ +l
  Potri.001G188500.2 116 CLHCGAEKTPQWRTGPMGPKTLCNACGVRYKSGRL 150
                         99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.2E-701199IPR016679Transcription factor, GATA, plant
SMARTSM004011.6E-17110160IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.23E-15114174No hitNo description
Gene3DG3DSA:3.30.50.108.4E-15114148IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.464114146IPR000679Zinc finger, GATA-type
CDDcd002021.17E-12115162No hitNo description
PfamPF003208.3E-16116150IPR000679Zinc finger, GATA-type
PROSITE patternPS003440116141IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MAELEWLSNF VEDSFSTDQS LQTNIHILSG SKPPTPESSS SETHHPEPIT CNPSNPAFQP  60
ETPLPGKARS KRSRAAPCDW STRLLHVPST TKMSSEKQLR ESPDPNLDSN AMVRRCLHCG  120
AEKTPQWRTG PMGPKTLCNA CGVRYKSGRL VPEYRPAASP TFVSAKHSNS HRKVLELRRQ  180
KEVQGAQQQQ FLSQSSIFGV *
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G188500.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046757.11e-143PREDICTED: GATA transcription factor 9-like
SwissprotO826325e-64GATA9_ARATH; GATA transcription factor 9
TrEMBLA0A2K2C0071e-146A0A2K2C007_POPTR; Uncharacterized protein
STRINGXP_002515981.11e-102(Ricinus communis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.12e-61GATA transcription factor 9
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]