PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G188500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 251aa    MW: 28010.3 Da    PI: 5.3658
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G188500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.14.9e-18166200135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +Cg+ kTp+WR gp g+ktLCnaCG++y++ +l
  Potri.001G188500.1 166 CLHCGAEKTPQWRTGPMGPKTLCNACGVRYKSGRL 200
                         99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.4E-7214249IPR016679Transcription factor, GATA, plant
SMARTSM004011.6E-17160210IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.2E-14164198IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577163.42E-15164224No hitNo description
PROSITE profilePS5011411.464164196IPR000679Zinc finger, GATA-type
CDDcd002025.86E-14165212No hitNo description
PfamPF003201.2E-15166200IPR000679Zinc finger, GATA-type
PROSITE patternPS003440166191IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEGPKFFTGG YNDCGATEFF SEKKSADQHF TVEDLLDFPN DDDDIMAGGF FSDIDDLCFA  60
DSQFSTELCF LYDDMAELEW LSNFVEDSFS TDQSLQTNIH ILSGNPAFQP ETPLPGKARS  120
KRSRAAPCDW STRLLHVPST TKMSSEKQLR ESPDPNLDSN AMVRRCLHCG AEKTPQWRTG  180
PMGPKTLCNA CGVRYKSGRL VPEYRPAASP TFVSAKHSNS HRKVLELRRQ KEVQGAQQQQ  240
FLSQSSIFGV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046757.11e-167PREDICTED: GATA transcription factor 9-like
SwissprotO826326e-67GATA9_ARATH; GATA transcription factor 9
TrEMBLA0A067KXE61e-115A0A067KXE6_JATCU; Uncharacterized protein
STRINGVIT_09s0002g03750.t012e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.14e-63GATA transcription factor 9