PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G184100.5
Common NamePOPTR_0001s18470g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 687aa    MW: 76968.4 Da    PI: 7.11
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G184100.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.31.9e-213287156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  Potri.001G184100.5 32 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIK 87
                        7999************************************************9877 PP

2START224.72.9e-702024253206
                         HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         a++a++el k+a+a+ep+W +s+    e++n+de+++ f ++++       +s+ea+r++gvv+ ++++lv++++d+  qW+e+++    k
  Potri.001G184100.5 202 ANQAMEELKKMATAGEPLWIRSVetgrEILNYDEYTKVFGSEDSsingrpkRSIEASRETGVVFIDVPRLVQSFMDVD-QWKEMFPclisK 291
                         7899***********************************88777999*******************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a+t++vi++g      ga+qlm+ae q+l+p+vp R+++fvRy++ql+a++w+ivdvS+d  +++  ++s+v+++++pSg++ie+ksngh+
  Potri.001G184100.5 292 AATVDVICNGegasrnGAVQLMFAEVQMLTPMVPtREVYFVRYCKQLNAEQWAIVDVSIDKVEDNI-DASLVKCRKRPSGCIIEDKSNGHC 381
                         ****************************************************************98.9*********************** PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kv+wveh  ++++++h ++r +v+sgl +ga++w+atlq qce+
  Potri.001G184100.5 382 KVIWVEHLQCQKSTVHTMYRTVVHSGLTFGARHWMATLQLQCER 425
                         ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-231883IPR009057Homeodomain-like
SuperFamilySSF466897.52E-212090IPR009057Homeodomain-like
PROSITE profilePS5007118.222989IPR001356Homeobox domain
SMARTSM003898.3E-193193IPR001356Homeobox domain
PfamPF000469.0E-193287IPR001356Homeobox domain
CDDcd000861.30E-163987No hitNo description
PROSITE patternPS0002706487IPR017970Homeobox, conserved site
PROSITE profilePS5084838.742191428IPR002913START domain
SuperFamilySSF559615.63E-33193425No hitNo description
CDDcd088756.77E-111195424No hitNo description
SMARTSM002346.9E-71200425IPR002913START domain
Gene3DG3DSA:3.30.530.204.4E-5201236IPR023393START-like domain
PfamPF018523.8E-56202425IPR002913START domain
Gene3DG3DSA:3.30.530.204.4E-5310420IPR023393START-like domain
SuperFamilySSF559612.47E-13456660No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MRSKSDDDFE GEGEHDHEDD DDGDDKNKKK KRKKYHRHTA EQIREMEALF KESPHPDEKQ  60
RQQLSKQLGL APRQVKFWFQ NRRTQIKAIQ ERHENSLLKS EMDKLREDNK SMRETINKAC  120
CPNCGTATTS RDAALTSTEE QQLRIENAKL KAEVEKLRAV VGKSSPGATA SCSAGNEQEN  180
RSSLDFYTGI FGLDKSRIME TANQAMEELK KMATAGEPLW IRSVETGREI LNYDEYTKVF  240
GSEDSSINGR PKRSIEASRE TGVVFIDVPR LVQSFMDVDQ WKEMFPCLIS KAATVDVICN  300
GEGASRNGAV QLMFAEVQML TPMVPTREVY FVRYCKQLNA EQWAIVDVSI DKVEDNIDAS  360
LVKCRKRPSG CIIEDKSNGH CKVIWVEHLQ CQKSTVHTMY RTVVHSGLTF GARHWMATLQ  420
LQCERLVFFM ATNVPTKDST GVATLAGRKS ILKLAQRMTW SFCRAICASS YHTWNKVSSK  480
TGEDIRVSSR KNLNDPGEPV GVILCAVSSV WLPVVPHILF DFLRDEARRN EWDIMSNGGP  540
VQTIANLIKG QDRGNAAAIL KMKSKENNMW VLQDSCTNAY ESMIVYAPVD TNGMQSVITG  600
CDSSNLAILP SGFSILPDGH ESRPLVITSR QEERSTEGGC LLTIAFQILT NTSPTAKPTM  660
ESVDSINTLI SCTLKNIKTS LQCEDS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12732KKKKRK
22733KKKKRKK
32933KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.131650.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing trichomes.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for correct morphological development and maturation of trichomes as well as for normal development of seed coat mucilage. Regulates the frequency of trichome initiation and determines trichome spacing. {ECO:0000269|PubMed:11844112}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G184100.5
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by GEM. {ECO:0000269|PubMed:17450124}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024462179.10.0homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A2K2BZS90.0A0A2K2BZS9_POPTR; Uncharacterized protein
STRINGPOPTR_0001s18470.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Wu R,Citovsky V
    Adaptor proteins GIR1 and GIR2. I. Interaction with the repressor GLABRA2 and regulation of root hair development.
    Biochem. Biophys. Res. Commun., 2017. 488(3): p. 547-553
    [PMID:28526410]