PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G184100.4
Common NamePOPTR_0001s18470g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 715aa    MW: 79888.4 Da    PI: 6.2992
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G184100.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.32e-2160115156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  Potri.001G184100.4  60 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIK 115
                         7999************************************************9877 PP

2START224.53.2e-702304533206
                         HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         a++a++el k+a+a+ep+W +s+    e++n+de+++ f ++++       +s+ea+r++gvv+ ++++lv++++d+  qW+e+++    k
  Potri.001G184100.4 230 ANQAMEELKKMATAGEPLWIRSVetgrEILNYDEYTKVFGSEDSsingrpkRSIEASRETGVVFIDVPRLVQSFMDVD-QWKEMFPclisK 319
                         7899***********************************88777999*******************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a+t++vi++g      ga+qlm+ae q+l+p+vp R+++fvRy++ql+a++w+ivdvS+d  +++  ++s+v+++++pSg++ie+ksngh+
  Potri.001G184100.4 320 AATVDVICNGegasrnGAVQLMFAEVQMLTPMVPtREVYFVRYCKQLNAEQWAIVDVSIDKVEDNI-DASLVKCRKRPSGCIIEDKSNGHC 409
                         ****************************************************************98.9*********************** PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kv+wveh  ++++++h ++r +v+sgl +ga++w+atlq qce+
  Potri.001G184100.4 410 KVIWVEHLQCQKSTVHTMYRTVVHSGLTFGARHWMATLQLQCER 453
                         ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-2346111IPR009057Homeodomain-like
SuperFamilySSF466898.13E-2148118IPR009057Homeodomain-like
PROSITE profilePS5007118.2257117IPR001356Homeobox domain
SMARTSM003898.3E-1959121IPR001356Homeobox domain
PfamPF000469.5E-1960115IPR001356Homeobox domain
CDDcd000861.14E-1667115No hitNo description
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PROSITE profilePS5084838.742219456IPR002913START domain
SuperFamilySSF559616.18E-33221453No hitNo description
CDDcd088751.63E-110223452No hitNo description
SMARTSM002346.9E-71228453IPR002913START domain
Gene3DG3DSA:3.30.530.204.5E-5229264IPR023393START-like domain
PfamPF018524.1E-56230453IPR002913START domain
Gene3DG3DSA:3.30.530.204.5E-5338448IPR023393START-like domain
SuperFamilySSF559612.61E-13484688No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MEVEEGEEGS GGGRREETVE ISSENSGPMR SKSDDDFEGE GEHDHEDDDD GDDKNKKKKR  60
KKYHRHTAEQ IREMEALFKE SPHPDEKQRQ QLSKQLGLAP RQVKFWFQNR RTQIKAIQER  120
HENSLLKSEM DKLREDNKSM RETINKACCP NCGTATTSRD AALTSTEEQQ LRIENAKLKA  180
EVEKLRAVVG KSSPGATASC SAGNEQENRS SLDFYTGIFG LDKSRIMETA NQAMEELKKM  240
ATAGEPLWIR SVETGREILN YDEYTKVFGS EDSSINGRPK RSIEASRETG VVFIDVPRLV  300
QSFMDVDQWK EMFPCLISKA ATVDVICNGE GASRNGAVQL MFAEVQMLTP MVPTREVYFV  360
RYCKQLNAEQ WAIVDVSIDK VEDNIDASLV KCRKRPSGCI IEDKSNGHCK VIWVEHLQCQ  420
KSTVHTMYRT VVHSGLTFGA RHWMATLQLQ CERLVFFMAT NVPTKDSTGV ATLAGRKSIL  480
KLAQRMTWSF CRAICASSYH TWNKVSSKTG EDIRVSSRKN LNDPGEPVGV ILCAVSSVWL  540
PVVPHILFDF LRDEARRNEW DIMSNGGPVQ TIANLIKGQD RGNAAAILKM KSKENNMWVL  600
QDSCTNAYES MIVYAPVDTN GMQSVITGCD SSNLAILPSG FSILPDGHES RPLVITSRQE  660
ERSTEGGCLL TIAFQILTNT SPTAKPTMES VDSINTLISC TLKNIKTSLQ CEDS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15560KKKKRK
25561KKKKRKK
35761KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.131650.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing trichomes.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for correct morphological development and maturation of trichomes as well as for normal development of seed coat mucilage. Regulates the frequency of trichome initiation and determines trichome spacing. {ECO:0000269|PubMed:11844112}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G184100.4
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by GEM. {ECO:0000269|PubMed:17450124}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024462179.10.0homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A2K2BZS90.0A0A2K2BZS9_POPTR; Uncharacterized protein
TrEMBLA0A2K2BZT80.0A0A2K2BZT8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s18470.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Wu R,Citovsky V
    Adaptor proteins GIR1 and GIR2. I. Interaction with the repressor GLABRA2 and regulation of root hair development.
    Biochem. Biophys. Res. Commun., 2017. 488(3): p. 547-553
    [PMID:28526410]