PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G184100.3
Common NamePOPTR_0001s18470g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 758aa    MW: 84236.3 Da    PI: 6.2604
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G184100.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.2e-21103158156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  Potri.001G184100.3 103 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIK 158
                         7999************************************************9877 PP

2START224.43.5e-702734963206
                         HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         a++a++el k+a+a+ep+W +s+    e++n+de+++ f ++++       +s+ea+r++gvv+ ++++lv++++d+  qW+e+++    k
  Potri.001G184100.3 273 ANQAMEELKKMATAGEPLWIRSVetgrEILNYDEYTKVFGSEDSsingrpkRSIEASRETGVVFIDVPRLVQSFMDVD-QWKEMFPclisK 362
                         7899***********************************88777999*******************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a+t++vi++g      ga+qlm+ae q+l+p+vp R+++fvRy++ql+a++w+ivdvS+d  +++  ++s+v+++++pSg++ie+ksngh+
  Potri.001G184100.3 363 AATVDVICNGegasrnGAVQLMFAEVQMLTPMVPtREVYFVRYCKQLNAEQWAIVDVSIDKVEDNI-DASLVKCRKRPSGCIIEDKSNGHC 452
                         ****************************************************************98.9*********************** PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kv+wveh  ++++++h ++r +v+sgl +ga++w+atlq qce+
  Potri.001G184100.3 453 KVIWVEHLQCQKSTVHTMYRTVVHSGLTFGARHWMATLQLQCER 496
                         ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-2389154IPR009057Homeodomain-like
SuperFamilySSF466898.55E-2191161IPR009057Homeodomain-like
PROSITE profilePS5007118.22100160IPR001356Homeobox domain
SMARTSM003898.3E-19102164IPR001356Homeobox domain
PfamPF000461.0E-18103158IPR001356Homeobox domain
CDDcd000865.81E-17110158No hitNo description
PROSITE patternPS000270135158IPR017970Homeobox, conserved site
PROSITE profilePS5084838.742262499IPR002913START domain
SuperFamilySSF559616.87E-33264496No hitNo description
CDDcd088754.08E-110266495No hitNo description
SMARTSM002346.9E-71271496IPR002913START domain
Gene3DG3DSA:3.30.530.205.1E-5272307IPR023393START-like domain
PfamPF018524.6E-56273496IPR002913START domain
Gene3DG3DSA:3.30.530.205.1E-5381491IPR023393START-like domain
SuperFamilySSF559613.02E-13527731No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MGVDMSNPPN SHIKDFFASP ALSLSLAGIF RGANVCNGEA AASMEVEEGE EGSGGGRREE  60
TVEISSENSG PMRSKSDDDF EGEGEHDHED DDDGDDKNKK KKRKKYHRHT AEQIREMEAL  120
FKESPHPDEK QRQQLSKQLG LAPRQVKFWF QNRRTQIKAI QERHENSLLK SEMDKLREDN  180
KSMRETINKA CCPNCGTATT SRDAALTSTE EQQLRIENAK LKAEVEKLRA VVGKSSPGAT  240
ASCSAGNEQE NRSSLDFYTG IFGLDKSRIM ETANQAMEEL KKMATAGEPL WIRSVETGRE  300
ILNYDEYTKV FGSEDSSING RPKRSIEASR ETGVVFIDVP RLVQSFMDVD QWKEMFPCLI  360
SKAATVDVIC NGEGASRNGA VQLMFAEVQM LTPMVPTREV YFVRYCKQLN AEQWAIVDVS  420
IDKVEDNIDA SLVKCRKRPS GCIIEDKSNG HCKVIWVEHL QCQKSTVHTM YRTVVHSGLT  480
FGARHWMATL QLQCERLVFF MATNVPTKDS TGVATLAGRK SILKLAQRMT WSFCRAICAS  540
SYHTWNKVSS KTGEDIRVSS RKNLNDPGEP VGVILCAVSS VWLPVVPHIL FDFLRDEARR  600
NEWDIMSNGG PVQTIANLIK GQDRGNAAAI LKMKSKENNM WVLQDSCTNA YESMIVYAPV  660
DTNGMQSVIT GCDSSNLAIL PSGFSILPDG HESRPLVITS RQEERSTEGG CLLTIAFQIL  720
TNTSPTAKPT MESVDSINTL ISCTLKNIKT SLQCEDS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198103KKKKRK
298104KKKKRKK
3100104KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.131650.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing trichomes.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for correct morphological development and maturation of trichomes as well as for normal development of seed coat mucilage. Regulates the frequency of trichome initiation and determines trichome spacing. {ECO:0000269|PubMed:11844112}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G184100.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by GEM. {ECO:0000269|PubMed:17450124}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024462179.10.0homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A2K2BZS90.0A0A2K2BZS9_POPTR; Uncharacterized protein
STRINGPOPTR_0001s18470.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Wu R,Citovsky V
    Adaptor proteins GIR1 and GIR2. I. Interaction with the repressor GLABRA2 and regulation of root hair development.
    Biochem. Biophys. Res. Commun., 2017. 488(3): p. 547-553
    [PMID:28526410]