PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G184100.1
Common NamePOPTR_0001s18470g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 765aa    MW: 85053.3 Da    PI: 6.3624
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G184100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.2e-21103158156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  Potri.001G184100.1 103 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIK 158
                         7999************************************************9877 PP

2START224.43.6e-702805033206
                         HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         a++a++el k+a+a+ep+W +s+    e++n+de+++ f ++++       +s+ea+r++gvv+ ++++lv++++d+  qW+e+++    k
  Potri.001G184100.1 280 ANQAMEELKKMATAGEPLWIRSVetgrEILNYDEYTKVFGSEDSsingrpkRSIEASRETGVVFIDVPRLVQSFMDVD-QWKEMFPclisK 369
                         7899***********************************88777999*******************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a+t++vi++g      ga+qlm+ae q+l+p+vp R+++fvRy++ql+a++w+ivdvS+d  +++  ++s+v+++++pSg++ie+ksngh+
  Potri.001G184100.1 370 AATVDVICNGegasrnGAVQLMFAEVQMLTPMVPtREVYFVRYCKQLNAEQWAIVDVSIDKVEDNI-DASLVKCRKRPSGCIIEDKSNGHC 459
                         ****************************************************************98.9*********************** PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kv+wveh  ++++++h ++r +v+sgl +ga++w+atlq qce+
  Potri.001G184100.1 460 KVIWVEHLQCQKSTVHTMYRTVVHSGLTFGARHWMATLQLQCER 503
                         ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-2389154IPR009057Homeodomain-like
SuperFamilySSF466891.37E-2091159IPR009057Homeodomain-like
PROSITE profilePS5007118.479100160IPR001356Homeobox domain
SMARTSM003894.1E-18102164IPR001356Homeobox domain
PfamPF000461.0E-18103158IPR001356Homeobox domain
CDDcd000866.02E-17110158No hitNo description
PROSITE patternPS000270135158IPR017970Homeobox, conserved site
PROSITE profilePS5084838.742269506IPR002913START domain
SuperFamilySSF559617.0E-33271503No hitNo description
CDDcd088755.03E-110273502No hitNo description
SMARTSM002346.9E-71278503IPR002913START domain
Gene3DG3DSA:3.30.530.205.2E-5279314IPR023393START-like domain
PfamPF018524.7E-56280503IPR002913START domain
Gene3DG3DSA:3.30.530.205.2E-5388498IPR023393START-like domain
SuperFamilySSF559613.02E-13534738No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MGVDMSNPPN SHIKDFFASP ALSLSLAGIF RGANVCNGEA AASMEVEEGE EGSGGGRREE  60
TVEISSENSG PMRSKSDDDF EGEGEHDHED DDDGDDKNKK KKRKKYHRHT AEQIREMEAL  120
FKESPHPDEK QRQQLSKQLG LAPRQVKFWF QNRRTQIKAR TLVLYAIQER HENSLLKSEM  180
DKLREDNKSM RETINKACCP NCGTATTSRD AALTSTEEQQ LRIENAKLKA EVEKLRAVVG  240
KSSPGATASC SAGNEQENRS SLDFYTGIFG LDKSRIMETA NQAMEELKKM ATAGEPLWIR  300
SVETGREILN YDEYTKVFGS EDSSINGRPK RSIEASRETG VVFIDVPRLV QSFMDVDQWK  360
EMFPCLISKA ATVDVICNGE GASRNGAVQL MFAEVQMLTP MVPTREVYFV RYCKQLNAEQ  420
WAIVDVSIDK VEDNIDASLV KCRKRPSGCI IEDKSNGHCK VIWVEHLQCQ KSTVHTMYRT  480
VVHSGLTFGA RHWMATLQLQ CERLVFFMAT NVPTKDSTGV ATLAGRKSIL KLAQRMTWSF  540
CRAICASSYH TWNKVSSKTG EDIRVSSRKN LNDPGEPVGV ILCAVSSVWL PVVPHILFDF  600
LRDEARRNEW DIMSNGGPVQ TIANLIKGQD RGNAAAILKM KSKENNMWVL QDSCTNAYES  660
MIVYAPVDTN GMQSVITGCD SSNLAILPSG FSILPDGHES RPLVITSRQE ERSTEGGCLL  720
TIAFQILTNT SPTAKPTMES VDSINTLISC TLKNIKTSLQ CEDS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198103KKKKRK
298104KKKKRKK
3100104KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.131650.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing trichomes.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for correct morphological development and maturation of trichomes as well as for normal development of seed coat mucilage. Regulates the frequency of trichome initiation and determines trichome spacing. {ECO:0000269|PubMed:11844112}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G184100.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by GEM. {ECO:0000269|PubMed:17450124}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090000.0AC209000.1 Populus trichocarpa clone POP023-H09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024462179.10.0homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A2K2BZS90.0A0A2K2BZS9_POPTR; Uncharacterized protein
STRINGPOPTR_0001s18470.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47143352
Representative plantOGRP9080913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Wu R,Citovsky V
    Adaptor proteins GIR1 and GIR2. I. Interaction with the repressor GLABRA2 and regulation of root hair development.
    Biochem. Biophys. Res. Commun., 2017. 488(3): p. 547-553
    [PMID:28526410]