PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G169600.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 154aa    MW: 18080.4 Da    PI: 6.7842
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G169600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.4e-163075148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  Potri.001G169600.2 30 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 75
                        78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.298124IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.5E-121036IPR009057Homeodomain-like
SuperFamilySSF466892.37E-211084IPR009057Homeodomain-like
PROSITE profilePS5129425.6722579IPR017930Myb domain
SMARTSM007171.9E-152977IPR001005SANT/Myb domain
PfamPF002491.0E-143075IPR001005SANT/Myb domain
CDDcd001677.37E-103475No hitNo description
Gene3DG3DSA:1.10.10.602.8E-213775IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MEDNRIQTLN RCGKSCRLRW LNYLRPNIKR GNISDQEEDL ILRLHKLLGN RWSLIAGRLP  60
GRTDNEIKNY WNSHLSKKIN KKGKQIEASN RECQKIEKKT VEISLELKED NKPHNGSEEG  120
SNVNFNIDDL FDFTDEDTLN MEWMSRFLEM DEA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-20108039109B-MYB
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed in leaf primordia. Later confined to developing trichome cells where it persists at high levels throughout all stages of trichome development. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15728674}.
UniprotTISSUE SPECIFICITY: Expressed in roots, seed coats, leaves, stems and flowers. Detected specifically in trichomes, and in the cell division and differentiation zone of the root. {ECO:0000269|PubMed:11437443}.
UniprotTISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}.
UniProtTranscription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching. {ECO:0000269|PubMed:11437443, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15668208, ECO:0000269|PubMed:15728674}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G169600.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2729167e-67GU272916.1 Populus balsamifera isolate HAY07 haplotype A myb family transcription factor gene, partial sequence.
GenBankGU2729177e-67GU272917.1 Populus balsamifera isolate HAY07 haplotype B myb family transcription factor gene, partial sequence.
GenBankGU2729217e-67GU272921.1 Populus balsamifera isolate KUU07 haplotype B myb family transcription factor gene, partial sequence.
GenBankGU2729277e-67GU272927.1 Populus balsamifera isolate NWL07 haplotype B myb family transcription factor gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298097.11e-103transcription factor MYB114
SwissprotQ962767e-40MYB23_ARATH; Transcription factor MYB23
SwissprotQ9SEI04e-40WER_ARATH; Transcription factor WER
TrEMBLB9GKV11e-102B9GKV1_POPTR; Uncharacterized protein
STRINGPOPTR_0001s16970.11e-103(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.12e-42myb domain protein 66
Publications ? help Back to Top
  1. Savage N, et al.
    Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
    PLoS ONE, 2013. 8(10): p. e75452
    [PMID:24130712]
  2. Cheng Y, et al.
    Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases.
    Elife, 2018.
    [PMID:24771765]
  3. Khosla A, et al.
    HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23.
    Plant Cell, 2014. 26(5): p. 2184-2200
    [PMID:24824485]
  4. Yu D, et al.
    RPN1a, a subunit of the 26S proteasome, controls trichome development in Arabidopsis.
    Plant Physiol. Biochem., 2015. 88: p. 82-8
    [PMID:25676129]
  5. Kiefer CS, et al.
    Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity.
    Development, 2015. 142(5): p. 1022
    [PMID:25715402]
  6. Kwak SH,Song SK,Lee MM,Schiefelbein J
    TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(12): p. e1103407
    [PMID:26451798]
  7. Zhu Y, et al.
    The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development.
    Plant Cell, 2017. 29(2): p. 260-276
    [PMID:28138017]
  8. Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
    Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
    Plant J., 2017. 92(2): p. 305-316
    [PMID:28771873]
  9. Mira MM, et al.
    Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit.
    J. Exp. Bot., 2017. 68(20): p. 5653-5668
    [PMID:29059380]
  10. Lung SC, et al.
    Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
    New Phytol., 2018. 218(1): p. 183-200
    [PMID:29288621]
  11. Kohanová J, et al.
    Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
    Ann. Bot., 2018. 122(5): p. 903-914
    [PMID:29394308]