PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G169100.1
Common NamePOPTR_0001s16920g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 347aa    MW: 38924.1 Da    PI: 7.674
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G169100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.53.1e-2577120144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgrsrsrk++e
  Potri.001G169100.1  77 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRSRSRKPVE 120
                         79***************************************987 PP

2QLQ60.83.7e-211246236
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                        +FTa+Q+q+L++Q+l+yKy+++++PvPpeLl  ++
  Potri.001G169100.1 12 PFTATQWQELEHQALIYKYMVSGVPVPPELLYSVK 46
                        8*****************************97775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.0E-131147IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.5E-161245IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.8451247IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.28777121IPR014977WRC domain
PfamPF088795.6E-2178120IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MLNTTISRNR FPFTATQWQE LEHQALIYKY MVSGVPVPPE LLYSVKRSLG SSLASRLFPH  60
QPIGWGCFQA GFGRKADPEP GRCRRTDGKK WRCSKEAYPD SKYCERHMHR GRSRSRKPVE  120
LTSSTTTTAT TIPLTSINRN LSNPTISPSS SSYSFSHPSS AESEVYAHQN PSHGTFLNPF  180
LYPHSSSSGP PDSGFSPLNS TPHNLFLESG SSPQVDKEHR YYHGMREDVD ERAFFPDGLG  240
SARGVQDSYN QLTMSSYKGY SLSQFQTFAD TSKEEQQQPG QHCFVLGTDI IKSSATRSIK  300
LEKETETLKP LHHFFDEWEP KDADSWLDLA SSSRPHTSGY LCFADD*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}.
UniprotTISSUE SPECIFICITY: Strongly expressed in actively growing and developing tissues, such as roots, upper stems, and shoot tips containing the shoot apical meristem (SAM) and flower buds. Also expressed in mature flowers, but weakly expressed in mature stems and leaves. {ECO:0000269|PubMed:12974814, ECO:0000269|PubMed:15960617}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Acts together with GIF1 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. {ECO:0000269|PubMed:15326298, ECO:0000269|PubMed:15960617}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G169100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2175881e-126AC217588.1 Populus trichocarpa clone POP047-P10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298093.30.0growth-regulating factor 5 isoform X1
SwissprotQ8L8A65e-63GRF5_ARATH; Growth-regulating factor 5
TrEMBLA0A2K2BZ130.0A0A2K2BZ13_POPTR; Uncharacterized protein
STRINGPOPTR_0001s16920.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97443137
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-64growth-regulating factor 5