PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G168800.1
Common NameHNO1, POPTR_0001s16890g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 557aa    MW: 62145.7 Da    PI: 7.2689
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G168800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS266.11.2e-811675462374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL  cA a+  g+++++q+lL  l+elas +gd+++Rlaay ++AL ++l++s++  +++  + + ++++ +   ++l  f+evsP++ 
  Potri.001G168800.1 167 EQLLNPCAAAIPIGNMSRVQHLLYVLHELASLTGDANHRLAAYGLRALTHHLSSSSTLSSASTGTITFASTEPKFFQKSLLKFYEVSPWFA 257
                         689**************************************************94444444445555665555555566666********* PP

                GRAS  93 fshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfA 169
                         f h +aN  Il+ +++e    + +H++D+++s+G+QWp+Ll+aL+ Rp ++pp +RiT++ +++++               +  +rL  fA
  Potri.001G168800.1 258 FPHNIANASILQVLAQEqdprRNLHVLDIGVSHGVQWPTLLEALTRRPgGPPPLVRITVITAASENdqttetpfsIGPPGDNFSSRLLGFA 348
                         ***************998888899************************55566*******998877777776666666778999******* PP

                GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..ns.esFlerf 257
                         ++++++++++ l  ++l++l+ + +++kp+Eal+V+ +++lh+l    +++++er+e+L+++++l+Pk v+++e+++d+  ns ++F+++f
  Potri.001G168800.1 349 KSMNINLQIKRLDNHSLQKLSGRIIDTKPDEALIVCAQFRLHHLN---HNTPDERTEFLRVLRRLEPKGVILTENNMDCscNScGDFATGF 436
                         ***********9999*****************************8...77777889********************8875444259***** PP

                GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sd 347
                         ++ +ey + ++ds+++ +    + r +vEr++++ e+ ++++++g++    +e +ekW er++ +GF    ++e+a + a++llrk++ ++
  Potri.001G168800.1 437 SRRVEYLWRFLDSTSSAF----KGRESVERRMMEGEAAKALTNRGEM----NEGKEKWCERMRGVGFVGELFGEDAIDGARALLRKYDsNW 519
                         **************9886....99*********************99....9************************************999 PP

                GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                         ++r e ++g++ l Wk++p+ ++S W+
  Potri.001G168800.1 520 EMRGEGKDGCVGLWWKGQPVSFCSLWK 546
                         9*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.388140525IPR005202Transcription factor GRAS
PfamPF035144.2E-79167546IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MTIEESEPSH TSDHVLDWLE DSVSFVPSFF DDPYSTADTN PYQWWDQAEE FYQDLVNTNA  60
SLSSSITTST TTNINTTSLV PPITPTLSNH PQSTTSNKKR KDPEDPVTKT SQNHHQRKNP  120
NNWINKKQQD GEAVVVVKKS NGNKKTTNKG TGINGNNGNN KEGRWAEQLL NPCAAAIPIG  180
NMSRVQHLLY VLHELASLTG DANHRLAAYG LRALTHHLSS SSTLSSASTG TITFASTEPK  240
FFQKSLLKFY EVSPWFAFPH NIANASILQV LAQEQDPRRN LHVLDIGVSH GVQWPTLLEA  300
LTRRPGGPPP LVRITVITAA SENDQTTETP FSIGPPGDNF SSRLLGFAKS MNINLQIKRL  360
DNHSLQKLSG RIIDTKPDEA LIVCAQFRLH HLNHNTPDER TEFLRVLRRL EPKGVILTEN  420
NMDCSCNSCG DFATGFSRRV EYLWRFLDST SSAFKGRESV ERRMMEGEAA KALTNRGEMN  480
EGKEKWCERM RGVGFVGELF GEDAIDGARA LLRKYDSNWE MRGEGKDGCV GLWWKGQPVS  540
FCSLWKLDMK GSESKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-2319454625375GRAS family transcription factor containing p
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in epidermal and cortical root cells. {ECO:0000269|PubMed:15961669}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ9724860.0AJ972486.1 Populus trichocarpa HNO1 gene for Nodulation Signaling Pathway 1 protein homologue 1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299589.10.0nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLQ4VYC40.0Q4VYC4_POPTR; Nodulation Signaling Pathway 1 protein homologue 1
STRINGPOPTR_0001s16890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Representative plantOGRP40821525
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-167GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]