PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G155300.2
Common NamePOPTR_0001s15510g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 338aa    MW: 36352.2 Da    PI: 7.3584
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G155300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.17.6e-12102146347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ Iar     R++ q+ s+ qky
  Potri.001G155300.2 102 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRSPTQVASHAQKY 146
                         8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.106.6E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.40495151IPR017930Myb domain
SuperFamilySSF466893.44E-1697152IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-1898150IPR006447Myb domain, plants
SMARTSM007171.5E-1099149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1099145IPR009057Homeodomain-like
PfamPF002491.9E-10102146IPR001005SANT/Myb domain
CDDcd001674.90E-9102147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RVVKLFGVRL TDGSIRKSAS MGNLSLYTGS SNMGGPHASG  60
SNNPGSPSDT PDHGAAAAAD GYASEDFVPG SSSSRERKKG VPWTEEEHRM FLLGLQKLGK  120
GDWRGIARNY VISRSPTQVA SHAQKYFIRQ SNVSRRKRRS SLFDIVADEQ LDTPMVSQDF  180
LSTNHPRVDT QTDNPLPAPP PLDEECESMD STNSNEGEPL PPKPDSSQPA YPVVYPAYLS  240
PFFPCSFPFW SGCSAEPSKT ETHEVLKPTA VHSKSPINVD ELVGMSKLSI GESIGDDGSS  300
SLSLKLLEGP SRQSAFHANP ASNSSGINRS SSPIHAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.113010.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates during leaf expansion. First observed at the tip of the leaves 12 days after sowing (DAS). At 14 DAS, expressed throughout the leaf blade to fade out thereafter in a basipetal manner. In mature leaves, detected in vascular tissue, especially in companion cells (PubMed:24806884). Accumulates to higher levels in old rosette leaves than in young rosette and cauline leaves (PubMed:25920996). {ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
UniprotTISSUE SPECIFICITY: Expressed ubiquitously, except in hypocotyls, root tips and lateral root primordia. {ECO:0000269|PubMed:25920996}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G155300.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:23888064, ECO:0000269|PubMed:24806884, ECO:0000269|PubMed:25920996}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368993.10.0transcription factor KUA1
SwissprotQ9LVS01e-136KUA1_ARATH; Transcription factor KUA1
TrEMBLB9MUR90.0B9MUR9_POPTR; Uncharacterized protein
STRINGPOPTR_0001s15510.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-117MYB_related family protein
Publications ? help Back to Top
  1. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]